GlyCosmos Portal

Submissions

Protein Rae1

Summary

UniProt ID: Q9W2E7
Gene Symbol: CG9862 Rae1
Gene ID: 37467
Organism: Drosophila melanogaster (fruit fly)

External Links

GlyGen: Q9W2E7
PubChem: Q9W2E7
O-GlcNAcAtlas: Q9W2E7
Re-Glyco: Q9W2E7

Annotation

Keyword: Chromosome Cytoplasm Meiosis Mitosis Nucleus Reference proteome Repeat Spermatogenesis Transport WD repeat

Gene Ontology (GO)

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
mitotic cell cycle	IMP	PMID
transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery	IBA	GO_REF
RNA export from nucleus	IBA	GO_REF
male meiosis I	IMP	PMID
spermatogenesis	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

cell cycle [inference]

mitotic cell cycle

signal transduction [inference]

intracellular signal transduction [inference]

hippo signaling

intercellular transport [inference]

nuclear export [inference]

RNA export from nucleus

cell cycle process [inference]

meiotic cell cycle process [inference]

meiosis I cell cycle process [inference]

meiosis I [inference]

male meiosis I

meiotic nuclear division [inference]

meiosis I [inference]

male meiosis I

male meiotic nuclear division [inference]

male meiosis I

cellular developmental process [inference]

cell differentiation

cell division

cellular localization [inference]

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport [inference]

nuclear export [inference]

RNA export from nucleus

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

organelle fission [inference]

nuclear division [inference]

meiotic nuclear division [inference]

meiosis I [inference]

male meiosis I

male meiotic nuclear division [inference]

male meiosis I

chromosome organization [inference]

transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery

reproductive process [inference]

developmental process involved in reproduction [inference]

spermatogenesis

multicellular organismal reproductive process [inference]

gamete generation [inference]

male gamete generation [inference]

spermatogenesis

meiotic cell cycle process [inference]

meiosis I cell cycle process [inference]

meiosis I [inference]

male meiosis I

meiotic nuclear division [inference]

meiosis I [inference]

male meiosis I

male meiotic nuclear division [inference]

male meiosis I

developmental process [inference]

developmental process involved in reproduction [inference]

spermatogenesis

cellular developmental process [inference]

cell differentiation

localization [inference]

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

nuclear export [inference]

RNA export from nucleus

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport [inference]

nuclear export [inference]

RNA export from nucleus

nitrogen compound transport [inference]

nucleobase-containing compound transport [inference]

nucleic acid transport [inference]

RNA transport [inference]

RNA export from nucleus

establishment of RNA localization [inference]

RNA transport [inference]

RNA export from nucleus

establishment of localization in cell [inference]

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport [inference]

nuclear export [inference]

RNA export from nucleus

cellular localization [inference]

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport [inference]

nuclear export [inference]

RNA export from nucleus

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of hippo signaling

regulation of intracellular signal transduction [inference]

regulation of hippo signaling

positive regulation of hippo signaling

positive regulation of intracellular signal transduction [inference]

positive regulation of hippo signaling

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of hippo signaling

regulation of growth [inference]

negative regulation of growth [inference]

negative regulation of developmental growth [inference]

negative regulation of synaptic assembly at neuromuscular junction

regulation of developmental growth

regulation of synaptic assembly at neuromuscular junction [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of developmental growth [inference]

negative regulation of synaptic assembly at neuromuscular junction

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of hippo signaling

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of hippo signaling

positive regulation of cell cycle [inference]

positive regulation of mitotic cell cycle [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle process [inference]

positive regulation of cell cycle phase transition [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle G1/S phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of hippo signaling

negative regulation of biological process [inference]

negative regulation of growth [inference]

negative regulation of developmental growth [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of cellular process [inference]

negative regulation of cellular component organization [inference]

negative regulation of cell junction assembly [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of synapse organization [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of neuromuscular junction development [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of developmental process [inference]

negative regulation of developmental growth [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of nervous system development [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of multicellular organismal process [inference]

negative regulation of nervous system development [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of hippo signaling

regulation of intracellular signal transduction [inference]

regulation of hippo signaling

positive regulation of hippo signaling

positive regulation of intracellular signal transduction [inference]

positive regulation of hippo signaling

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of hippo signaling

regulation of developmental process [inference]

regulation of developmental growth

regulation of synaptic assembly at neuromuscular junction [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of developmental growth [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of developmental process [inference]

negative regulation of developmental growth [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of nervous system development [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

negative regulation of nervous system development [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

hippo signaling

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of hippo signaling

regulation of intracellular signal transduction [inference]

regulation of hippo signaling

positive regulation of hippo signaling

positive regulation of intracellular signal transduction [inference]

positive regulation of hippo signaling

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of hippo signaling

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of catabolic process [inference]

regulation of autophagy

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of cell population proliferation

regulation of cellular component biogenesis [inference]

regulation of cell junction assembly [inference]

regulation of synapse assembly [inference]

regulation of synaptic assembly at neuromuscular junction [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of cell junction assembly [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of hippo signaling

positive regulation of cell cycle [inference]

positive regulation of mitotic cell cycle [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle process [inference]

positive regulation of cell cycle phase transition [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle G1/S phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

negative regulation of cellular process [inference]

negative regulation of cellular component organization [inference]

negative regulation of cell junction assembly [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of synapse organization [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of neuromuscular junction development [inference]

negative regulation of synaptic assembly at neuromuscular junction

regulation of cellular component organization [inference]

regulation of synapse organization [inference]

regulation of synapse assembly [inference]

regulation of synaptic assembly at neuromuscular junction [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

regulation of neuromuscular junction development [inference]

regulation of synaptic assembly at neuromuscular junction [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of neuromuscular junction development [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of synapse organization [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of neuromuscular junction development [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of cellular component organization [inference]

negative regulation of cell junction assembly [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of synapse organization [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of neuromuscular junction development [inference]

negative regulation of synaptic assembly at neuromuscular junction

regulation of cell junction assembly [inference]

regulation of synapse assembly [inference]

regulation of synaptic assembly at neuromuscular junction [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

negative regulation of cell junction assembly [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

positive regulation of mitotic cell cycle [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of mitotic cell cycle phase transition [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of G1/S transition of mitotic cell cycle

positive regulation of G1/S transition of mitotic cell cycle

regulation of cell cycle process [inference]

positive regulation of cell cycle process [inference]

positive regulation of cell cycle phase transition [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle G1/S phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of cell cycle phase transition [inference]

positive regulation of cell cycle phase transition [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle G1/S phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of mitotic cell cycle phase transition [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of G1/S transition of mitotic cell cycle

positive regulation of G1/S transition of mitotic cell cycle

regulation of cell cycle G1/S phase transition [inference]

positive regulation of cell cycle G1/S phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of G1/S transition of mitotic cell cycle

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle [inference]

positive regulation of mitotic cell cycle [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle process [inference]

positive regulation of cell cycle phase transition [inference]

positive regulation of mitotic cell cycle phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

positive regulation of cell cycle G1/S phase transition [inference]

positive regulation of G1/S transition of mitotic cell cycle

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of nervous system development [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

negative regulation of nervous system development [inference]

negative regulation of synapse assembly [inference]

negative regulation of synaptic assembly at neuromuscular junction

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	IDA	PMID PMID
nucleus	IEA	GO_REF
nuclear envelope	NAS	PMID
nuclear envelope	IDA	PMID PMID
nuclear envelope	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

nuclear protein-containing complex [inference]

nuclear pore

cellular anatomical structure [inference]

cytoplasm

organelle envelope [inference]

nuclear envelope

cell projection [inference]

plasma membrane bounded cell projection [inference]

cilium [inference]

motile cilium [inference]

9+2 motile cilium [inference]

sperm flagellum

organelle [inference]

membrane-bounded organelle [inference]

cilium [inference]

motile cilium [inference]

9+2 motile cilium [inference]

sperm flagellum

intracellular membrane-bounded organelle [inference]

nucleus

mitochondrial derivative [inference]

Nebenkern

membraneless organelle [inference]

intracellular membraneless organelle [inference]

chromosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

mitochondrial derivative [inference]

Nebenkern

intracellular membraneless organelle [inference]

chromosome

Displaying **all 2** entries
GO Term	Evidence Code	Reference
RNA binding	IBA	GO_REF
ubiquitin binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

RNA binding

protein binding [inference]

ubiquitin-like protein binding [inference]

ubiquitin binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MFGATQSTNRMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATVPKSMKTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKGPTYTCLMTGSWDKTLKFWDTRSPNPMMTINLPERCYCADVEYPMAVVGTANRGLIIYSLQNSPTEYKRQESPLKYQHRAISIFRDKKKEPTGCALGSIEGRVAIQYVNPGNPKDNFTFKCHRTTGTSGYQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSETMDQSITKCGFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
211			G49108TO	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 13 in total

1

2

Next ›

Last »
Pathway Name	Organism
IP3 and IP4 transport between cytosol and nucleus	Drosophila melanogaster
IP6 and IP7 transport between cytosol and nucleus	Drosophila melanogaster
IPs transport between nucleus and cytosol	Drosophila melanogaster
Nuclear Pore Complex (NPC) Disassembly	Drosophila melanogaster
Regulation of HSF1-mediated heat shock response	Drosophila melanogaster
SUMOylation of DNA damage response and repair proteins	Drosophila melanogaster
SUMOylation of DNA replication proteins	Drosophila melanogaster
SUMOylation of SUMOylation proteins	Drosophila melanogaster
SUMOylation of chromatin organization proteins	Drosophila melanogaster
Transport of Mature mRNA Derived from an Intronless Transcript	Drosophila melanogaster

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements