GlyCosmos Portal

Annotation

Keyword: Acetylation Activator Alternative splicing Glycoprotein Isopeptide bond Methylation Nucleus Phosphoprotein RNA-binding Reference proteome Repressor Ribonucleoprotein Spliceosome Transcription Tumor suppressor Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
regulation of alternative mRNA splicing, via spliceosome	ISO	GO_REF
transcription by RNA polymerase II	ISO	GO_REF
mRNA splice site recognition	ISO	GO_REF
membrane protein ectodomain proteolysis	ISO	GO_REF
positive regulation of DNA-templated transcription	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

protein metabolic process [inference]

proteolysis [inference]

membrane protein proteolysis [inference]

membrane protein ectodomain proteolysis

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

protein metabolic process [inference]

proteolysis [inference]

membrane protein proteolysis [inference]

membrane protein ectodomain proteolysis

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

protein-containing complex assembly [inference]

protein-RNA complex assembly [inference]

mRNA splice site recognition

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

protein-RNA complex assembly [inference]

mRNA splice site recognition

protein-RNA complex organization [inference]

protein-RNA complex assembly [inference]

mRNA splice site recognition

response to stimulus [inference]

response to chemical [inference]

response to peptide [inference]

response to cytokine [inference]

response to interleukin-1 [inference]

cellular response to interleukin-1

cellular response to cytokine stimulus [inference]

cellular response to interleukin-1

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of RNA splicing [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of RNA splicing [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA metabolic process [inference]

regulation of mRNA processing [inference]

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA metabolic process [inference]

regulation of mRNA processing [inference]

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA splicing [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of cellular component organization [inference]

regulation of synapse organization [inference]

regulation of postsynapse organization

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
euchromatin	ISO	GO_REF
nucleus	ISO	GO_REF
nucleus	IEA	GO_REF
spliceosomal complex	IBA	GO_REF
postsynaptic density	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex

nuclear protein-containing complex [inference]

spliceosomal complex

catalytic complex [inference]

catalytic step 2 spliceosome

ribonucleoprotein complex [inference]

spliceosomal complex

cellular anatomical structure [inference]

chromatin [inference]

euchromatin

cell junction [inference]

synapse [inference]

glutamatergic synapse

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

nucleus

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

postsynaptic specialization [inference]

postsynaptic density

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISO	GO_REF
chromatin binding	ISO	GO_REF
RNA binding	ISO	GO_REF
RNA binding	IEA	GO_REF
single-stranded RNA binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

DNA binding [inference]

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

sequence-specific DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

RNA binding

chromatin binding

protein binding [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGLPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFTMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGLGGRAPVSRGRDGYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSREYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
137			G27126ED	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 8** entries
Pathway Name	Organism
Processing of Capped Intron-Containing Pre-mRNA	Mus musculus
RHOBTB1 GTPase cycle	Mus musculus
RHOBTB2 GTPase cycle	Mus musculus
RND1 GTPase cycle	Mus musculus
RND2 GTPase cycle	Mus musculus
RND3 GTPase cycle	Mus musculus
mRNA Polyadenylation	Mus musculus
pre-mRNA splicing	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements