Submissions
GlyTouCan
Glycan Structure Repository
GlyComb
Glycoconjugate Repository
GlycoPOST
Glycomics MS raw data Repository
UniCarb-DR
Glycomics MS Repository for glycan annotations from GlycoWorkbench
LM-GlycoRepo
Repository for lectin-assisted multimodality data
All Resources
Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / OrganismsTools
SugarDrawer
GlycanBuilder
Glycan Converters
GlycoMaple
GlycomeAtlas
LM-GlycomeAtlas
GALAXY
MCAW
GlycoSim
GRable
Guidelines
MIRAGE
Glycogen synthase kinase-3 beta
Summary
- UniProt ID
- Q9WV60
- Gene Symbol
- Gsk3b
- Gene ID
- 56637
- Organism
- Mus musculus (house mouse)
Annotation
- Keyword
- 3D-structure ADP-ribosylation ATP-binding Biological rhythms Cell membrane Cytoplasm Developmental protein Differentiation Glycogen metabolism Neurogenesis Nucleus Palmitate Phosphoprotein Reference proteome Serine/threonine-protein kinase Signal transduction inhibitor Wnt signaling pathway
Gene Ontology (GO)
| GO Term | Evidence Code | Reference |
|---|---|---|
| G1/S transition of mitotic cell cycle | ||
| re-entry into mitotic cell cycle | ||
| regulation of cell growth | ||
| regulation of cell growth | ||
| epithelial to mesenchymal transition |
GO Hierarchy
- regulation of circadian rhythm
biological process
cellular process [inference]
response to stimulus [inference]
biological regulation [inference]
regulation of biological process [inference]
regulation of immune system process [inference]
regulation of signaling [inference]
regulation of localization [inference]
regulation of growth [inference]
positive regulation of biological process [inference]
positive regulation of cellular process [inference]
positive regulation of metabolic process [inference]
positive regulation of cell differentiation
positive regulation of cellular component organization [inference]
positive regulation of transport [inference]
positive regulation of developmental process [inference]
negative regulation of biological process [inference]
negative regulation of cellular process [inference]
negative regulation of developmental process [inference]
regulation of response to stimulus [inference]
regulation of developmental process [inference]
regulation of cell differentiation [inference]
regulation of developmental growth [inference]
negative regulation of developmental process [inference]
positive regulation of developmental process [inference]
regulation of cellular process [inference]
signal transduction [inference]
regulation of cell communication [inference]
regulation of metabolic process [inference]
regulation of biosynthetic process [inference]
negative regulation of metabolic process [inference]
positive regulation of metabolic process [inference]
regulation of catabolic process [inference]
regulation of macromolecule metabolic process [inference]
regulation of macromolecule biosynthetic process [inference]
positive regulation of macromolecule metabolic process [inference]
negative regulation of macromolecule metabolic process [inference]
regulation of protein metabolic process [inference]
regulation of primary metabolic process [inference]
regulation of nucleobase-containing compound metabolic process [inference]
regulation of protein metabolic process [inference]
regulation of programmed cell death [inference]
regulation of cellular component biogenesis [inference]
regulation of cell differentiation [inference]
positive regulation of cellular process [inference]
positive regulation of metabolic process [inference]
positive regulation of cell differentiation
positive regulation of cellular component organization [inference]
negative regulation of cellular process [inference]
regulation of cellular component organization [inference]
regulation of cell projection organization [inference]
regulation of synapse organization [inference]
negative regulation of cellular component organization [inference]
positive regulation of cellular component organization [inference]
regulation of multicellular organismal process [inference]
| GO Term | Evidence Code | Reference |
|---|---|---|
| protease binding | ||
| protease binding | ||
| p53 binding | ||
| p53 binding | ||
| protein kinase activity |
Sequence
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
Glycosylation Sites
| Position | Description | PubMed ID | GlyTouCan ID | Source |
|---|---|---|---|---|
| 9 |
|
|||
| 389 |
|
|||
| 395 |
|
|||
| 417 |
|
G49108TO
Feature
: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt
Pathway
| Pathway Name | Organism |
|---|---|
| B-WICH complex positively regulates rRNA expression | Mus musculus |
| Beta-catenin phosphorylation cascade | Mus musculus |
| CRMPs in Sema3A signaling | Mus musculus |
| Degradation of beta-catenin by the destruction complex | Mus musculus |
| Disassembly of the destruction complex and recruitment of AXIN to the membrane | Mus musculus |
| GLI3 is processed to GLI3R by the proteasome | Mus musculus |
| GSK3B and BTRC:CUL1-mediated-degradation of NFE2L2 | Mus musculus |
| GSK3B-mediated proteasomal degradation of PD-L1(CD274) | Mus musculus |
| Regulation of HSF1-mediated heat shock response | Mus musculus |
| Transcriptional and post-translational regulation of MITF-M expression and activity | Mus musculus |
