GlyCosmos Portal

Submissions

Dematin

Summary

UniProt ID: Q9WV69
Gene Symbol: Dmtn Epb4.9 Epb49
Gene ID: 13829
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9WV69
PubChem: Q9WV69
The O-GlcNAc Database: Q9WV69
RaftProt: Q9WV69
O-GlcNAcAtlas: Q9WV69
Re-Glyco: Q9WV69

Annotation

Keyword: Actin capping Actin-binding Alternative splicing Cell membrane Cell projection Cytoskeleton Disulfide bond Phosphoprotein Reference proteome Repeat Tumor suppressor

Gene Ontology (GO)

Displaying entries **1 - 5** of 37 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
regulation of cell shape	ISS	GO_REF
regulation of cell shape	ISO	GO_REF
regulation of cell shape	IDA	PMID
regulation of cell shape	IEA	GO_REF GO_REF
regulation of lamellipodium assembly	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

actin filament-based process [inference]

actin cytoskeleton organization

cellular developmental process [inference]

cell development [inference]

hemopoiesis [inference]

myeloid cell development [inference]

erythrocyte development

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to cAMP

cellular response to oxygen-containing compound [inference]

cellular response to cAMP

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

actin cytoskeleton organization

endoplasmic reticulum organization [inference]

endoplasmic reticulum tubular network organization

cellular component assembly [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

lamellipodium assembly

cell projection organization [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

lamellipodium assembly

plasma membrane bounded cell projection organization [inference]

lamellipodium organization [inference]

lamellipodium assembly

plasma membrane bounded cell projection assembly [inference]

lamellipodium assembly

regulation of cellular component size [inference]

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

regulation of actin filament depolymerization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

protein-containing complex organization [inference]

protein-containing complex assembly

supramolecular fiber organization [inference]

actin filament organization [inference]

actin filament bundle organization [inference]

actin filament bundle assembly

developmental process [inference]

anatomical structure development [inference]

cell development [inference]

hemopoiesis [inference]

myeloid cell development [inference]

erythrocyte development

cellular developmental process [inference]

cell development [inference]

hemopoiesis [inference]

myeloid cell development [inference]

erythrocyte development

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis [inference]

endoplasmic reticulum calcium ion homeostasis [inference]

smooth endoplasmic reticulum calcium ion homeostasis

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis [inference]

endoplasmic reticulum calcium ion homeostasis [inference]

smooth endoplasmic reticulum calcium ion homeostasis

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis [inference]

endoplasmic reticulum calcium ion homeostasis [inference]

smooth endoplasmic reticulum calcium ion homeostasis

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis [inference]

endoplasmic reticulum calcium ion homeostasis [inference]

smooth endoplasmic reticulum calcium ion homeostasis

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis [inference]

endoplasmic reticulum calcium ion homeostasis [inference]

smooth endoplasmic reticulum calcium ion homeostasis

inorganic ion homeostasis [inference]

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis [inference]

endoplasmic reticulum calcium ion homeostasis [inference]

smooth endoplasmic reticulum calcium ion homeostasis

response to stimulus [inference]

response to chemical [inference]

response to organophosphorus [inference]

response to cAMP [inference]

cellular response to cAMP

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to cAMP

cellular response to oxygen-containing compound [inference]

cellular response to cAMP

response to nitrogen compound [inference]

response to purine-containing compound [inference]

response to cAMP [inference]

cellular response to cAMP

cellular response to nitrogen compound [inference]

cellular response to cAMP

response to oxygen-containing compound [inference]

response to cAMP [inference]

cellular response to cAMP

cellular response to oxygen-containing compound [inference]

cellular response to cAMP

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to cAMP

cellular response to oxygen-containing compound [inference]

cellular response to cAMP

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein targeting [inference]

regulation of protein targeting to membrane [inference]

negative regulation of protein targeting to membrane

negative regulation of establishment of protein localization [inference]

negative regulation of protein targeting to membrane

regulation of cellular localization [inference]

regulation of protein targeting to membrane [inference]

negative regulation of protein targeting to membrane

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of fibroblast migration [inference]

positive regulation of fibroblast migration

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

positive regulation of biological process [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

positive regulation of cellular process [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

positive regulation of response to stimulus [inference]

positive regulation of response to wounding [inference]

positive regulation of wound healing

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-substrate adhesion

negative regulation of cell-matrix adhesion [inference]

negative regulation of focal adhesion assembly

negative regulation of substrate adhesion-dependent cell spreading

negative regulation of metabolic process [inference]

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of actin filament polymerization [inference]

actin filament capping

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

negative regulation of protein-containing complex disassembly [inference]

negative regulation of protein depolymerization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of cell-substrate junction organization [inference]

negative regulation of focal adhesion assembly

negative regulation of cell junction assembly [inference]

negative regulation of focal adhesion assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of actin filament polymerization [inference]

actin filament capping

negative regulation of protein targeting to membrane

negative regulation of establishment of protein localization [inference]

negative regulation of protein targeting to membrane

regulation of response to stimulus [inference]

positive regulation of response to stimulus [inference]

positive regulation of response to wounding [inference]

positive regulation of wound healing

regulation of response to stress [inference]

regulation of response to wounding [inference]

regulation of wound healing [inference]

positive regulation of wound healing

positive regulation of response to wounding [inference]

positive regulation of wound healing

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of cell morphogenesis [inference]

regulation of cell shape

regulation of cellular process [inference]

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

regulation of phosphorus metabolic process [inference]

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

regulation of phosphorylation [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

regulation of peptidyl-threonine phosphorylation [inference]

negative regulation of peptidyl-threonine phosphorylation

regulation of peptidyl-serine phosphorylation [inference]

negative regulation of peptidyl-serine phosphorylation

regulation of peptidyl-tyrosine phosphorylation [inference]

negative regulation of peptidyl-tyrosine phosphorylation

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

regulation of peptidyl-threonine phosphorylation [inference]

negative regulation of peptidyl-threonine phosphorylation

regulation of peptidyl-serine phosphorylation [inference]

negative regulation of peptidyl-serine phosphorylation

regulation of peptidyl-tyrosine phosphorylation [inference]

negative regulation of peptidyl-tyrosine phosphorylation

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

regulation of peptidyl-threonine phosphorylation [inference]

negative regulation of peptidyl-threonine phosphorylation

regulation of peptidyl-serine phosphorylation [inference]

negative regulation of peptidyl-serine phosphorylation

regulation of peptidyl-tyrosine phosphorylation [inference]

negative regulation of peptidyl-tyrosine phosphorylation

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-substrate adhesion

negative regulation of cell-matrix adhesion [inference]

negative regulation of focal adhesion assembly

negative regulation of substrate adhesion-dependent cell spreading

regulation of cell-substrate adhesion [inference]

regulation of cell-matrix adhesion [inference]

negative regulation of cell-matrix adhesion [inference]

negative regulation of focal adhesion assembly

regulation of focal adhesion assembly [inference]

negative regulation of focal adhesion assembly

negative regulation of cell-substrate adhesion

negative regulation of cell-matrix adhesion [inference]

negative regulation of focal adhesion assembly

negative regulation of substrate adhesion-dependent cell spreading

regulation of substrate adhesion-dependent cell spreading [inference]

negative regulation of substrate adhesion-dependent cell spreading

regulation of actin filament-based process [inference]

regulation of actin cytoskeleton organization

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

regulation of actin filament depolymerization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

regulation of actin filament organization [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

regulation of actin filament depolymerization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

regulation of protein polymerization [inference]

regulation of actin filament polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

negative regulation of protein polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of cell junction assembly [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

negative regulation of focal adhesion assembly

negative regulation of cell junction assembly [inference]

negative regulation of focal adhesion assembly

positive regulation of cellular process [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-substrate adhesion

negative regulation of cell-matrix adhesion [inference]

negative regulation of focal adhesion assembly

negative regulation of substrate adhesion-dependent cell spreading

negative regulation of metabolic process [inference]

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of actin filament polymerization [inference]

actin filament capping

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

negative regulation of protein-containing complex disassembly [inference]

negative regulation of protein depolymerization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of cell-substrate junction organization [inference]

negative regulation of focal adhesion assembly

negative regulation of cell junction assembly [inference]

negative regulation of focal adhesion assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of actin filament polymerization [inference]

actin filament capping

negative regulation of protein targeting to membrane

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of plasma membrane bounded cell projection organization [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of lamellipodium organization [inference]

regulation of lamellipodium assembly

regulation of organelle organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of actin filament polymerization [inference]

actin filament capping

regulation of cytoskeleton organization [inference]

regulation of actin cytoskeleton organization

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

regulation of actin filament depolymerization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

regulation of actin filament organization [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

regulation of actin filament depolymerization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of cytoskeleton organization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of actin filament polymerization [inference]

actin filament capping

regulation of protein-containing complex disassembly [inference]

negative regulation of protein-containing complex disassembly [inference]

negative regulation of protein depolymerization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

regulation of protein depolymerization [inference]

regulation of actin filament depolymerization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of protein depolymerization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

regulation of protein-containing complex assembly [inference]

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

regulation of protein polymerization [inference]

regulation of actin filament polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

negative regulation of protein polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of actin filament polymerization [inference]

actin filament capping

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

negative regulation of protein-containing complex disassembly [inference]

negative regulation of protein depolymerization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of cell-substrate junction organization [inference]

negative regulation of focal adhesion assembly

negative regulation of cell junction assembly [inference]

negative regulation of focal adhesion assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of actin filament polymerization [inference]

actin filament capping

regulation of cell-substrate junction organization [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

negative regulation of focal adhesion assembly

negative regulation of cell-substrate junction organization [inference]

negative regulation of focal adhesion assembly

regulation of cell junction assembly [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

negative regulation of focal adhesion assembly

negative regulation of cell junction assembly [inference]

negative regulation of focal adhesion assembly

regulation of supramolecular fiber organization [inference]

regulation of actin filament organization [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

regulation of actin filament depolymerization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of supramolecular fiber organization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

negative regulation of actin filament polymerization [inference]

actin filament capping

regulation of cellular localization [inference]

regulation of protein targeting to membrane [inference]

negative regulation of protein targeting to membrane

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of fibroblast migration [inference]

positive regulation of fibroblast migration

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

regulation of biological quality [inference]

regulation of cell shape

regulation of anatomical structure size [inference]

regulation of cellular component size [inference]

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization [inference]

negative regulation of actin filament polymerization [inference]

actin filament capping

regulation of actin filament depolymerization [inference]

negative regulation of actin filament depolymerization [inference]

actin filament capping

Displaying entries **1 - 5** of 32 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
smooth endoplasmic reticulum	IEA	GO_REF
cytosol	ISS	GO_REF
cytosol	ISO	GO_REF
cytosol	IDA	PMID
cytosol	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytosol

membrane

plasma membrane

organelle membrane [inference]

bounding membrane of organelle [inference]

platelet dense tubular network membrane

plasma membrane region [inference]

cell projection membrane

cell junction [inference]

synapse

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum [inference]

smooth endoplasmic reticulum

intracellular vesicle [inference]

cytoplasmic vesicle

membraneless organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum [inference]

smooth endoplasmic reticulum

intracellular vesicle [inference]

cytoplasmic vesicle

intracellular membraneless organelle [inference]

cytoskeleton [inference]

postsynaptic specialization [inference]

postsynaptic density

perinuclear region of cytoplasm

supramolecular complex [inference]

supramolecular polymer [inference]

supramolecular fiber [inference]

polymeric cytoskeletal fiber [inference]

actin filament

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
actin binding	ISS	GO_REF
actin binding	ISO	GO_REF
actin binding	IEA	GO_REF GO_REF
signaling receptor binding	ISS	GO_REF
signaling receptor binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding

cytoskeletal protein binding [inference]

actin binding

actin filament binding

spectrin binding

protein-containing complex binding [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MERLQKQPLTSPGSVSSSRDSSVPGSPSSIVAKMDNQVLGYKDLAAIPKDKAILDIERPDLMIYEPHFTYSLLEHVELPRSRECSLSPKSTSPPPSPEVWAESRTLGIISQASTPRTTGTPRTSLPHFHHPETTRPDSNIYKKPPIYKQRESVGGSPQSKHLIEDLIIESSKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEWRKRKASRKGAEEEEEEEDDDSEEEIKAIRERQKEELSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSLHSGTSKSSSLPSYGRTTLSRLQSTEFSPSGSEAGSPGLQNGEGQRGRMDRGNSLPCVLEQKIYPYEMLVVTNKGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKASLF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying entries **1 - 10** of 12 in total

1

2

Next ›

Last »
Position	PubMed ID	GlyTouCan ID	Source
17	19458039 22517741 22645316 30059200 34418053 34678516 35822049 36852467 40021952 40885482	G49108TO	The O-GlcNAc Database
18	19458039 22517741 22645316 30059200 34418053 34678516 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
105	19458039 22517741 22645316 30059200 34418053 34678516 35822049 36852467 40021952 40885482	G49108TO	The O-GlcNAc Database
110	19458039 22517741 22645316 30059200 34418053 34678516 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
123	19458039 22517741 22645316 30059200 34418053 34678516 35822049 36852467 40021952 40885482	G49108TO	The O-GlcNAc Database
133	19458039 22517741 22645316 30059200 34418053 34678516 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
134	19458039 22517741 22645316 30059200 34418053 34678516 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
138	19458039 22517741 22645316 30059200 34418053 34678516 35822049 36852467 40021952 40885482	G49108TO	The O-GlcNAc Database
152	19458039 22517741 22645316 30059200 34418053 34678516 35822049 36852467 40021952 40885482	G49108TO	The O-GlcNAc Database
274	19458039 22517741 22645316 30059200 34418053 34678516 35822049 36852467 40021952 40885482	G49108TO	The O-GlcNAc Database