GlyCosmos Portal

Submissions

EGF-containing fibulin-like extracellular matrix protein 2

Summary

UniProt ID: Q9WVJ9
Gene Symbol: Efemp2 Fbln4 Mbp1
Gene ID: 58859
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0007811
PubChem: Q9WVJ9
Re-Glyco: Q9WVJ9

Annotation

Keyword: Basement membrane Calcium Direct protein sequencing Disulfide bond EGF-like domain Glycoprotein Pyrrolidone carboxylic acid Reference proteome Repeat Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
aorta development	IMP	PMID
elastic fiber assembly	ISS	GO_REF
elastic fiber assembly	ISO	GO_REF
elastic fiber assembly	IMP	PMID PMID PMID PMID PMID PMID
elastic fiber assembly	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular developmental process [inference]

cell development [inference]

muscle cell development [inference]

vascular associated smooth muscle cell development

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

extracellular matrix assembly [inference]

elastic fiber assembly

extracellular structure organization [inference]

extracellular matrix organization [inference]

extracellular matrix assembly [inference]

elastic fiber assembly

external encapsulating structure organization [inference]

extracellular matrix organization [inference]

extracellular matrix assembly [inference]

elastic fiber assembly

supramolecular fiber organization [inference]

elastic fiber assembly

developmental process [inference]

anatomical structure morphogenesis [inference]

tissue morphogenesis [inference]

muscle tissue morphogenesis [inference]

aorta smooth muscle tissue morphogenesis

anatomical structure development [inference]

blood vessel development [inference]

artery development

aorta development

cell development [inference]

muscle cell development [inference]

vascular associated smooth muscle cell development

cellular developmental process [inference]

cell development [inference]

muscle cell development [inference]

vascular associated smooth muscle cell development

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of smooth muscle cell differentiation [inference]

positive regulation of vascular associated smooth muscle cell differentiation [inference]

positive regulation of aortic smooth muscle cell differentiation

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of smooth muscle cell-matrix adhesion

positive regulation of cellular component organization [inference]

positive regulation of extracellular matrix organization [inference]

positive regulation of collagen fibril organization

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of smooth muscle cell differentiation [inference]

positive regulation of vascular associated smooth muscle cell differentiation [inference]

positive regulation of aortic smooth muscle cell differentiation

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of smooth muscle cell proliferation [inference]

negative regulation of vascular associated smooth muscle cell proliferation

regulation of developmental process [inference]

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of smooth muscle cell differentiation [inference]

positive regulation of vascular associated smooth muscle cell differentiation [inference]

positive regulation of aortic smooth muscle cell differentiation

regulation of muscle cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of smooth muscle cell differentiation [inference]

positive regulation of vascular associated smooth muscle cell differentiation [inference]

positive regulation of aortic smooth muscle cell differentiation

regulation of smooth muscle cell differentiation [inference]

positive regulation of smooth muscle cell differentiation [inference]

positive regulation of vascular associated smooth muscle cell differentiation [inference]

positive regulation of aortic smooth muscle cell differentiation

regulation of vascular associated smooth muscle cell differentiation [inference]

regulation of aortic smooth muscle cell differentiation [inference]

positive regulation of aortic smooth muscle cell differentiation

positive regulation of vascular associated smooth muscle cell differentiation [inference]

positive regulation of aortic smooth muscle cell differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of smooth muscle cell differentiation [inference]

positive regulation of vascular associated smooth muscle cell differentiation [inference]

positive regulation of aortic smooth muscle cell differentiation

regulation of cellular process [inference]

regulation of cell adhesion [inference]

regulation of cell-substrate adhesion [inference]

regulation of cell-matrix adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of smooth muscle cell-matrix adhesion

regulation of smooth muscle cell-matrix adhesion [inference]

positive regulation of smooth muscle cell-matrix adhesion

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of smooth muscle cell-matrix adhesion

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of smooth muscle cell-matrix adhesion

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of smooth muscle cell proliferation [inference]

negative regulation of vascular associated smooth muscle cell proliferation

regulation of smooth muscle cell proliferation [inference]

negative regulation of smooth muscle cell proliferation [inference]

negative regulation of vascular associated smooth muscle cell proliferation

regulation of vascular associated smooth muscle cell proliferation [inference]

negative regulation of vascular associated smooth muscle cell proliferation

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of smooth muscle cell differentiation [inference]

positive regulation of vascular associated smooth muscle cell differentiation [inference]

positive regulation of aortic smooth muscle cell differentiation

regulation of muscle cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of smooth muscle cell differentiation [inference]

positive regulation of vascular associated smooth muscle cell differentiation [inference]

positive regulation of aortic smooth muscle cell differentiation

regulation of smooth muscle cell differentiation [inference]

positive regulation of smooth muscle cell differentiation [inference]

positive regulation of vascular associated smooth muscle cell differentiation [inference]

positive regulation of aortic smooth muscle cell differentiation

regulation of vascular associated smooth muscle cell differentiation [inference]

regulation of aortic smooth muscle cell differentiation [inference]

positive regulation of aortic smooth muscle cell differentiation

positive regulation of vascular associated smooth muscle cell differentiation [inference]

positive regulation of aortic smooth muscle cell differentiation

positive regulation of cellular process [inference]

positive regulation of cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of smooth muscle cell differentiation [inference]

positive regulation of vascular associated smooth muscle cell differentiation [inference]

positive regulation of aortic smooth muscle cell differentiation

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of smooth muscle cell-matrix adhesion

positive regulation of cellular component organization [inference]

positive regulation of extracellular matrix organization [inference]

positive regulation of collagen fibril organization

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of smooth muscle cell proliferation [inference]

negative regulation of vascular associated smooth muscle cell proliferation

regulation of cellular component organization [inference]

positive regulation of cellular component organization [inference]

positive regulation of extracellular matrix organization [inference]

positive regulation of collagen fibril organization

regulation of extracellular matrix organization [inference]

positive regulation of extracellular matrix organization [inference]

positive regulation of collagen fibril organization

regulation of collagen fibril organization

positive regulation of collagen fibril organization

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
microfibril
basement membrane	IDA	PMID
basement membrane	IEA	GO_REF
obsolete extracellular space
extracellular matrix	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

external encapsulating structure [inference]

extracellular matrix

basement membrane

supramolecular complex [inference]

supramolecular polymer [inference]

supramolecular fiber [inference]

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
calcium ion binding	IEA	GO_REF
heparin binding	ISS	GO_REF
heparin binding	ISO	GO_REF
heparin binding	IEA	GO_REF
protein homodimerization activity	ISS	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

calcium ion binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparin binding

sulfur compound binding [inference]

heparin binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLPFASCLPGSLLLWAFLLLLLGAASPQDPEEPDSYTECTDGYEWDADSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVISDLHGEGPPPPAAHAQQPNPCPQGYEPDEQESCVDVDECTQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCNQGYELHRDGFSCSDIDECGYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLCQDIDECETGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYVQVSDNRCLCPASNPLCREQPSSIVHRYMSITSERSVPADVFQIQATSVYPGAYNAFQIRSGNTQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites