GlyCosmos Portal

Submissions

Rhodopsin kinase GRK1

Summary

UniProt ID: Q9WVL4
Gene Symbol: Grk1 Rhok
Gene ID
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9WVL4
PubChem: Q9WVL4
Re-Glyco: Q9WVL4

Annotation

Keyword: ATP-binding Cell projection Membrane Methylation Phosphoprotein Prenylation Reference proteome Serine/threonine-protein kinase Vision

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
signal transduction	IEA	GO_REF
visual perception	IEA	GO_REF
photoreceptor cell morphogenesis	IMP	PMID
response to light stimulus	IMP	PMID
response to light stimulus	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

phosphorylation [inference]

protein phosphorylation [inference]

protein autophosphorylation

macromolecule metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

protein phosphorylation [inference]

protein autophosphorylation

macromolecule modification [inference]

protein modification process [inference]

protein phosphorylation [inference]

protein autophosphorylation

primary metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

protein phosphorylation [inference]

protein autophosphorylation

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of light stimulus [inference]

visual perception

developmental process [inference]

anatomical structure morphogenesis [inference]

cell morphogenesis [inference]

cell morphogenesis involved in neuron differentiation [inference]

photoreceptor cell morphogenesis

post-embryonic animal morphogenesis [inference]

post-embryonic retina morphogenesis in camera-type eye

response to stimulus [inference]

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction

regulation of G protein-coupled receptor signaling pathway [inference]

regulation of opsin-mediated signaling pathway

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

regulation of response to stimulus [inference]

regulation of signal transduction

regulation of G protein-coupled receptor signaling pathway [inference]

regulation of opsin-mediated signaling pathway

regulation of response to external stimulus [inference]

regulation of opsin-mediated signaling pathway

regulation of cellular process [inference]

signal transduction

regulation of cell communication [inference]

regulation of signal transduction

regulation of G protein-coupled receptor signaling pathway [inference]

regulation of opsin-mediated signaling pathway

regulation of metabolic process [inference]

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation

regulation of phosphorus metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation

regulation of phosphorylation [inference]

positive regulation of phosphorylation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

Displaying **all 5** entries
GO Term	Evidence Code	Reference
photoreceptor outer segment	IDA	PMID
photoreceptor outer segment	IEA	GO_REF
cytoplasm	IBA	GO_REF
membrane	ISS	GO_REF
membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
ATP binding	IEA	GO_REF
rhodopsin kinase activity	ISS	GO_REF
rhodopsin kinase activity	ISO	GO_REF GO_REF
rhodopsin kinase activity	EXP	PMID
rhodopsin kinase activity	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

kinase activity [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity [inference]

G protein-coupled receptor kinase activity [inference]

rhodopsin kinase activity

phosphotransferase activity, alcohol group as acceptor [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity [inference]

G protein-coupled receptor kinase activity [inference]

rhodopsin kinase activity

catalytic activity, acting on a protein [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity [inference]

G protein-coupled receptor kinase activity [inference]

rhodopsin kinase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDFGSLETVVANSAFIAARGSFDGSSTPSSRDKKYLAKLRLPPLSKCEGLRDNLSLEFESLCSEQPIGKRLFQQFLKTDERHVPALELWKDIEDYDTADDDLRPQKAQAILAEYLDPQGTLFCNFLDQGMVTRVKEGPTGSQDGLFQPLLQATMEHLSQAPFQEYLESLYFLRFLQWKWLEAQPIGEDWFLDFRVLGKGGFGEVSACQMKATGKMYACKKLNKKRLKKKKGYQGAIVEKRILTKVHSRFIVSLAYAFETKTDLCLVMTIMNGGDVRYHIYNVDEDNPGFSEPRAIYYTAQIISGLEHLHQRRIVYRDLKPENVLLDNDGNIRISDLGLAVELKEGQNKTKGYAGTPGFMAPELLRGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKQRIISEPVKYPEKFSQASKDFCEQLLEKDPEKRLGFRDGTCDALRANVLFKDISWRQLEAGMLIPPFIPDSRTVYAKNIQDVGAFSTVKGVVFDKADTEFFQEFASGNCSIPWQEEMIETGLFGDLNVWRADGQMPDDMKGITTEEAAPTAKSGMCLIS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
139				GlyGen
355				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Inactivation, recovery and regulation of the phototransduction cascade	Mus musculus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0110713	Oguchi disease-2	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements