GlyCosmos Portal

Submissions

Prostaglandin-H2 D-isomerase

Summary

UniProt ID: Q9XS65
Gene Symbol: PTGDS
Gene ID: 403740
Organism: Canis lupus familiaris (dog)

External Links

PubChem: Q9XS65
Re-Glyco: Q9XS65

Annotation

Keyword: Cytoplasm Disulfide bond Endoplasmic reticulum Glycoprotein Golgi apparatus Isomerase Mast cell degranulation Membrane Nucleus Prostaglandin biosynthesis Pyrrolidone carboxylic acid Reference proteome Secreted Signal Transport

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
prostaglandin biosynthetic process	ISS	GO_REF
mast cell degranulation
regulation of circadian sleep/wake cycle, sleep	ISS	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

leukocyte degranulation [inference]

mast cell degranulation

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

lipid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

unsaturated fatty acid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

icosanoid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

unsaturated fatty acid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

primary metabolic process [inference]

lipid metabolic process [inference]

fatty acid metabolic process [inference]

fatty acid biosynthetic process [inference]

unsaturated fatty acid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

unsaturated fatty acid metabolic process [inference]

unsaturated fatty acid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

prostanoid metabolic process [inference]

prostaglandin metabolic process [inference]

prostaglandin biosynthetic process

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

lipid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

unsaturated fatty acid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

small molecule metabolic process [inference]

organic acid metabolic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

icosanoid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

unsaturated fatty acid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

icosanoid metabolic process [inference]

prostanoid metabolic process [inference]

prostaglandin metabolic process [inference]

prostaglandin biosynthetic process

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

icosanoid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process [inference]

fatty acid biosynthetic process [inference]

unsaturated fatty acid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

unsaturated fatty acid metabolic process [inference]

unsaturated fatty acid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

prostanoid metabolic process [inference]

prostaglandin metabolic process [inference]

prostaglandin biosynthetic process

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

unsaturated fatty acid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

carboxylic acid biosynthetic process [inference]

icosanoid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

unsaturated fatty acid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

icosanoid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

unsaturated fatty acid biosynthetic process [inference]

prostanoid biosynthetic process [inference]

prostaglandin biosynthetic process

vesicle-mediated transport [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

export from cell [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

secretion [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

export from cell [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

establishment of localization in cell [inference]

leukocyte degranulation [inference]

mast cell degranulation

establishment of organelle localization [inference]

mast cell degranulation

organelle localization [inference]

establishment of organelle localization [inference]

mast cell degranulation

vacuolar localization [inference]

lysosome localization [inference]

mast cell degranulation

biological regulation [inference]

regulation of biological process [inference]

regulation of circadian rhythm [inference]

regulation of circadian sleep/wake cycle [inference]

regulation of circadian sleep/wake cycle, sleep

regulation of multicellular organismal process [inference]

regulation of behavior [inference]

regulation of circadian sleep/wake cycle [inference]

regulation of circadian sleep/wake cycle, sleep

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	IEA	GO_REF GO_REF
obsolete extracellular space
rough endoplasmic reticulum	ISS	GO_REF
rough endoplasmic reticulum	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

membrane [inference]

organelle membrane [inference]

nuclear membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum [inference]

rough endoplasmic reticulum

Golgi apparatus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum [inference]

rough endoplasmic reticulum

Golgi apparatus

perinuclear region of cytoplasm

Displaying **all 4** entries
GO Term	Evidence Code	Reference
prostaglandin-D synthase activity	ISS	GO_REF
prostaglandin-D synthase activity	IEA	GO_REF GO_REF
retinoid binding	ISS	GO_REF
small molecule binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

isomerase activity [inference]

intramolecular oxidoreductase activity [inference]

prostaglandin-D synthase activity

binding [inference]

lipid binding [inference]

isoprenoid binding [inference]

retinoid binding

small molecule binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGALCTLWLGLVLLGVLGALQTSAQAQVSLQPNFQQDKFLGRWFTSGLASNSSWFREKKNVLSMCMSVVAPTADGGLNLTSTFLRKDQCETRTLLLRPAGTPGCYSYTSPHWGSTHDVWVVATNYEEYALLYTAGSKGLGQDFHMATLYSRTQTPKAEIKEKFSTFAKTQGFTEDAIVFLPQTDKCMEENK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites