GlyCosmos Portal

Submissions

NADPH oxidase 1

Summary

UniProt ID: Q9Y5S8
Gene Symbol: MOX1 NOH1 NOX1
Gene ID: 27035
Organism: Homo sapiens (human)

External Links

GlyGen: Q9Y5S8
PubChem: Q9Y5S8
The Human Metabolome Database: HMDBP08279
Re-Glyco: Q9Y5S8

Annotation

Keyword: Alternative splicing Cell junction Cell membrane Cell projection Electron transport FAD Glycoprotein Heme NADP Oxidoreductase Phosphoprotein Proteomics identification Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 24 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis	IMP	PMID
regulation of systemic arterial blood pressure by renin-angiotensin
NADP+ metabolic process	IC	PMID
defense response	IBA	GO_REF
inflammatory response	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction

intracellular signal transduction [inference]

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to oxidative stress

intracellular signaling cassette [inference]

MAPK cascade [inference]

JNK cascade

apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to oxidative stress

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

NADP+ metabolic process

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

NADP+ metabolic process

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

NADP+ metabolic process

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process

small molecule metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

NADP+ metabolic process

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process

respiratory burst

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

NADP+ metabolic process

pyridine-containing compound metabolic process [inference]

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process

oxygen metabolic process

reactive oxygen species metabolic process [inference]

superoxide metabolic process [inference]

superoxide anion generation

hydrogen peroxide metabolic process

cell motility [inference]

cell migration

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to hyperoxia

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to hyperoxia

cellular response to oxygen levels [inference]

cellular response to increased oxygen levels [inference]

cellular response to hyperoxia

cellular component organization or biogenesis [inference]

cellular component organization [inference]

extracellular structure organization [inference]

extracellular matrix organization

external encapsulating structure organization [inference]

extracellular matrix organization

multicellular organismal process [inference]

system process [inference]

endocrine process [inference]

regulation of systemic arterial blood pressure by hormone [inference]

regulation of systemic arterial blood pressure by renin-angiotensin

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

response to stimulus [inference]

response to stress [inference]

defense response

inflammatory response

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to hyperoxia

response to hyperoxia [inference]

cellular response to hyperoxia

response to abiotic stimulus [inference]

response to oxygen levels [inference]

response to increased oxygen levels [inference]

cellular response to increased oxygen levels [inference]

cellular response to hyperoxia

response to hyperoxia [inference]

cellular response to hyperoxia

cellular response to oxygen levels [inference]

cellular response to increased oxygen levels [inference]

cellular response to hyperoxia

response to chemical [inference]

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to hyperoxia

cellular response to oxygen levels [inference]

cellular response to increased oxygen levels [inference]

cellular response to hyperoxia

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to hyperoxia

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to hyperoxia

cellular response to oxygen levels [inference]

cellular response to increased oxygen levels [inference]

cellular response to hyperoxia

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of cellular component organization [inference]

positive regulation of integrin biosynthetic process

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of cellular process [inference]

signal transduction

intracellular signal transduction [inference]

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to oxidative stress

intracellular signaling cassette [inference]

MAPK cascade [inference]

JNK cascade

apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to oxidative stress

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

regulation of integrin biosynthetic process [inference]

positive regulation of integrin biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

regulation of integrin biosynthetic process [inference]

positive regulation of integrin biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of cellular component organization [inference]

positive regulation of integrin biosynthetic process

regulation of cellular component organization [inference]

positive regulation of cellular component organization [inference]

positive regulation of integrin biosynthetic process

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of biological quality [inference]

regulation of blood pressure

regulation of systemic arterial blood pressure [inference]

regulation of systemic arterial blood pressure mediated by a chemical signal [inference]

regulation of systemic arterial blood pressure by hormone [inference]

regulation of systemic arterial blood pressure by renin-angiotensin

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
early endosome	IDA	PMID
plasma membrane	EXP	PMID
plasma membrane	TAS	Reactome Reactome Reactome Reactome Reactome Reactome
plasma membrane	IDA	PMID
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

NADPH oxidase complex

catalytic complex [inference]

oxidoreductase complex [inference]

NADPH oxidase complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

cell projection

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
NAD(P)H oxidase H2O2-forming activity	IBA	GO_REF
superoxide-generating NAD(P)H oxidase activity	TAS	PMID PMID
superoxide-generating NAD(P)H oxidase activity	IC	PMID
superoxide-generating NAD(P)H oxidase activity	IDA	PMID PMID
superoxide-generating NAD(P)H oxidase activity	IMP	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

oxidoreductase activity, acting on NAD(P)H [inference]

oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor [inference]

NAD(P)H oxidase H2O2-forming activity

superoxide-generating NAD(P)H oxidase activity

superoxide-generating NADPH oxidase activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

GTPase binding [inference]

small GTPase binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

NADP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

NADP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
162	N-linked (GlcNAc...) asparagine	24365146		UniProt GlyGen
236	N-linked (GlcNAc...) asparagine	24365146		UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
RAC1 GTPase cycle	Homo sapiens
RAC3 GTPase cycle	Homo sapiens
RHO GTPases Activate NADPH Oxidases	Homo sapiens
WNT5:FZD7-mediated leishmania damping	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements