GlyCosmos Portal

Submissions

Gamma-synuclein

Summary

UniProt ID

Q9Z0F7

Gene Symbol

Persyn
Sncg

Gene ID

[20618]

Organism

Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0007820
GlyGen: Q9Z0F7
PubChem: Q9Z0F7
The O-GlcNAc Database: Q9Z0F7
O-GlcNAcAtlas: Q9Z0F7
Re-Glyco: Q9Z0F7

Annotation

Keyword: Cytoskeleton Phosphoprotein Reference proteome Repeat

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
chemical synaptic transmission	IGI	PMID
chemical synaptic transmission	IBA	GO_REF
adult locomotory behavior	IGI	PMID
protein secretion	IDA	PMID
regulation of dopamine secretion	IGI	PMID

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission

vesicle-mediated transport [inference]

endocytosis [inference]

presynaptic endocytosis [inference]

synaptic vesicle endocytosis

vesicle-mediated transport in synapse [inference]

presynaptic endocytosis [inference]

synaptic vesicle endocytosis

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell junction organization [inference]

synapse organization

export from cell [inference]

secretion by cell [inference]

protein secretion

multicellular organismal process [inference]

behavior [inference]

locomotory behavior [inference]

adult locomotory behavior

adult behavior [inference]

adult locomotory behavior

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

protein secretion

protein localization to extracellular region [inference]

protein secretion

establishment of localization [inference]

transport [inference]

protein transport [inference]

protein secretion

vesicle-mediated transport [inference]

endocytosis [inference]

presynaptic endocytosis [inference]

synaptic vesicle endocytosis

vesicle-mediated transport in synapse [inference]

presynaptic endocytosis [inference]

synaptic vesicle endocytosis

secretion [inference]

secretion by cell [inference]

protein secretion

import into cell [inference]

endocytosis [inference]

presynaptic endocytosis [inference]

synaptic vesicle endocytosis

export from cell [inference]

secretion by cell [inference]

protein secretion

establishment of protein localization [inference]

protein transport [inference]

protein secretion

establishment of protein localization to extracellular region [inference]

protein secretion

establishment of localization in cell [inference]

presynaptic endocytosis [inference]

synaptic vesicle endocytosis

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of neurotransmitter secretion

signaling [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

regulation of secretion by cell [inference]

regulation of neurotransmitter secretion

regulation of catecholamine secretion [inference]

regulation of dopamine secretion

regulation of neurotransmitter transport [inference]

regulation of neurotransmitter secretion

regulation of amine transport [inference]

regulation of catecholamine secretion [inference]

regulation of dopamine secretion

regulation of response to stimulus [inference]

regulation of response to stress [inference]

regulation of cellular response to stress

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of neurotransmitter secretion

regulation of cellular response to stress

regulation of secretion by cell [inference]

regulation of neurotransmitter secretion

regulation of catecholamine secretion [inference]

regulation of dopamine secretion

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	ISO	GO_REF
cytoplasm	IDA	PMID PMID PMID
cytoplasm	IBA	GO_REF
cytoplasm	IEA	GO_REF
Golgi apparatus	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

microtubule organizing center [inference]

centrosome

cytosol

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

axon

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

spindle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular membraneless organelle [inference]

spindle

cell body [inference]

neuronal cell body

neuron projection terminus [inference]

axon terminus

perinuclear region of cytoplasm

presynapse [inference]

axon terminus

Displaying **all 3** entries
GO Term	Evidence Code	Reference
alpha-tubulin binding	ISO	GO_REF
beta-tubulin binding	ISO	GO_REF
cuprous ion binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

cytoskeletal protein binding [inference]

tubulin binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

copper ion binding [inference]

cuprous ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVANKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEENEEAKSGED

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 9** entries
Position	PubMed ID	GlyTouCan ID	Source
27	22517741 37507081 40021952 40885482	G49108TO	The O-GlcNAc Database
54	22517741 37507081 40021952 40885482	G49108TO	The O-GlcNAc Database
67	22517741 37507081 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
72	22517741 37507081 40021952 40885482	G49108TO	The O-GlcNAc Database
73	22517741 37507081 40021952 40885482	G49108TO	The O-GlcNAc Database
76	22517741 37507081 40021952 40885482	G49108TO	The O-GlcNAc Database
79		G83460ZZ	GlycoProtDB GlyGen
81	22517741 37507081 40021952 40885482	G49108TO	The O-GlcNAc Database
91	22517741 37507081 40021952 40885482	G49108TO	The O-GlcNAc Database