GlyCosmos Portal

Submissions

Proepiregulin

Summary

UniProt ID: Q9Z0L5
Gene Symbol: Ereg
Gene ID: 59325
Organism: Rattus norvegicus (Norway rat)

External Links

Re-Glyco: Q9Z0L5

Annotation

Keyword: Angiogenesis Cell membrane Developmental protein Differentiation Direct protein sequencing Disulfide bond EGF-like domain Glycoprotein Growth factor Mitogen Reference proteome Secreted Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 78 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis
ovarian cumulus expansion	IDA	PMID
oocyte maturation	IDA	PMID
positive regulation of cytokine production	ISS	GO_REF
positive regulation of cytokine production	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

ERBB signaling pathway [inference]

epidermal growth factor receptor signaling pathway

ERBB2-EGFR signaling pathway

ERBB2 signaling pathway [inference]

ERBB4 signaling pathway [inference]

cytokine-mediated signaling pathway

G protein-coupled receptor signaling pathway [inference]

luteinizing hormone signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mRNA transcription

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mRNA transcription

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mRNA transcription

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA transcription

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mRNA transcription

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mRNA transcription

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mRNA transcription

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA transcription

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mRNA transcription

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

mRNA transcription

cell population proliferation [inference]

epithelial cell proliferation [inference]

keratinocyte proliferation

cell cycle process [inference]

meiotic cell cycle process [inference]

meiotic nuclear division [inference]

female meiotic nuclear division

cellular developmental process [inference]

cell maturation [inference]

oocyte maturation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

organelle fission [inference]

nuclear division [inference]

meiotic nuclear division [inference]

female meiotic nuclear division

reproductive process [inference]

developmental process involved in reproduction [inference]

oocyte maturation

ovulation cycle process [inference]

ovarian cumulus expansion

multicellular organismal reproductive process [inference]

mammalian oogenesis stage [inference]

primary follicle stage

ovulation

meiotic cell cycle process [inference]

meiotic nuclear division [inference]

female meiotic nuclear division

developmental process [inference]

developmental process involved in reproduction [inference]

oocyte maturation

developmental maturation [inference]

anatomical structure maturation [inference]

cell maturation [inference]

oocyte maturation

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

cellular developmental process [inference]

cell maturation [inference]

oocyte maturation

growth [inference]

developmental growth [inference]

ovarian cumulus expansion

rhythmic process [inference]

ovulation cycle process [inference]

ovarian cumulus expansion

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone [inference]

response to peptide hormone

response to chemical [inference]

response to hormone [inference]

response to peptide hormone

response to nitrogen compound [inference]

response to peptide hormone

response to oxygen-containing compound [inference]

response to peptide hormone

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

positive regulation of innate immune response

regulation of immune response [inference]

regulation of innate immune response [inference]

positive regulation of innate immune response

positive regulation of immune response [inference]

positive regulation of innate immune response

signaling [inference]

cell-cell signaling

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

positive regulation of innate immune response

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

positive regulation of DNA metabolic process [inference]

positive regulation of DNA replication

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of cell division

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response

positive regulation of defense response [inference]

positive regulation of innate immune response

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response

positive regulation of immune response [inference]

positive regulation of innate immune response

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of smooth muscle cell differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of smooth muscle cell differentiation

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response

regulation of innate immune response [inference]

positive regulation of innate immune response

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response

regulation of innate immune response [inference]

positive regulation of innate immune response

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response

positive regulation of defense response [inference]

positive regulation of innate immune response

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response

positive regulation of immune response [inference]

positive regulation of innate immune response

regulation of immune response [inference]

regulation of innate immune response [inference]

positive regulation of innate immune response

positive regulation of immune response [inference]

positive regulation of innate immune response

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of innate immune response

regulation of innate immune response [inference]

positive regulation of innate immune response

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of smooth muscle cell differentiation

regulation of muscle cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of smooth muscle cell differentiation

regulation of smooth muscle cell differentiation [inference]

negative regulation of smooth muscle cell differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of smooth muscle cell differentiation

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

ERBB signaling pathway [inference]

epidermal growth factor receptor signaling pathway

ERBB2-EGFR signaling pathway

ERBB2 signaling pathway [inference]

ERBB4 signaling pathway [inference]

cytokine-mediated signaling pathway

G protein-coupled receptor signaling pathway [inference]

luteinizing hormone signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

positive regulation of DNA metabolic process [inference]

positive regulation of DNA replication

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

regulation of phosphorus metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity

regulation of phosphorylation [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

regulation of protein kinase activity [inference]

positive regulation of protein kinase activity

positive regulation of phosphorylation

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity

regulation of kinase activity [inference]

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity

regulation of protein kinase activity [inference]

positive regulation of protein kinase activity

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

positive regulation of DNA metabolic process [inference]

positive regulation of DNA replication

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of DNA metabolic process [inference]

regulation of DNA replication [inference]

positive regulation of DNA replication

positive regulation of DNA metabolic process [inference]

positive regulation of DNA replication

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

regulation of protein kinase activity [inference]

positive regulation of protein kinase activity

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of DNA metabolic process [inference]

regulation of DNA replication [inference]

positive regulation of DNA replication

positive regulation of DNA metabolic process [inference]

positive regulation of DNA replication

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

regulation of protein kinase activity [inference]

positive regulation of protein kinase activity

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

negative regulation of cell population proliferation

regulation of fibroblast proliferation [inference]

positive regulation of fibroblast proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of smooth muscle cell differentiation

regulation of muscle cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of smooth muscle cell differentiation

regulation of smooth muscle cell differentiation [inference]

negative regulation of smooth muscle cell differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

positive regulation of DNA metabolic process [inference]

positive regulation of DNA replication

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation [inference]

positive regulation of protein kinase activity

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of cell division

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of smooth muscle cell differentiation

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

regulation of nuclear division [inference]

regulation of mitotic nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

regulation of cell division [inference]

positive regulation of cell division

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

regulation of mitotic nuclear division [inference]

positive regulation of mitotic nuclear division

regulation of cell cycle process [inference]

regulation of mitotic nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production

positive regulation of interleukin-6 production

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of molecular function [inference]

positive regulation of molecular function [inference]

positive regulation of catalytic activity [inference]

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity

regulation of catalytic activity [inference]

positive regulation of catalytic activity [inference]

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity

regulation of transferase activity [inference]

regulation of kinase activity [inference]

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity

regulation of protein kinase activity [inference]

positive regulation of protein kinase activity

Displaying **all 3** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
plasma membrane	ISS	GO_REF
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
epidermal growth factor receptor binding	ISS	GO_REF
epidermal growth factor receptor binding	ISO	GO_REF
epidermal growth factor receptor binding	IBA	GO_REF
epidermal growth factor receptor binding	IEA	GO_REF
growth factor activity	TAS	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

growth factor receptor binding [inference]

epidermal growth factor receptor binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

kinase regulator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

protein kinase regulator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

receptor ligand activity

growth factor activity

molecular function activator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

signaling receptor activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

receptor ligand activity

growth factor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

METFPAAWVLALLCLGSHLLQAVISTTVIPSCIPEESEDNCTALVQMEDDPRVAQVLITKCSSDMDGYCLHGHCIYLVDMSEKYCRCEVGYTGLRCEHFFLTVHQPLSREYVALTVILVFLFLIVTAGSMYYFCRWYRNRKSKKSREEYERVTSGGPGLPQV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
40	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 22 in total

1

2

3

Next ›

Last »
Pathway Name	Organism
Cargo recognition for clathrin-mediated endocytosis	Rattus norvegicus
Clathrin-mediated endocytosis	Rattus norvegicus
Downregulation of ERBB2 signaling	Rattus norvegicus
EGFR downregulation	Rattus norvegicus
EGFR interacts with phospholipase C-gamma	Rattus norvegicus
ERBB2 Activates PTK6 Signaling	Rattus norvegicus
ERBB2 Regulates Cell Motility	Rattus norvegicus
Extra-nuclear estrogen signaling	Rattus norvegicus
GAB1 signalosome	Rattus norvegicus
GRB2 events in EGFR signaling	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements