GlyCosmos Portal

Submissions

Interleukin-18-binding protein

Summary

UniProt ID: Q9Z0M9
Gene Symbol: Igifbp Il18bp
Gene ID: 16068
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0007834
PubChem: Q9Z0M9
Re-Glyco: Q9Z0M9

Annotation

Keyword: Direct protein sequencing Disulfide bond Glycoprotein Immunoglobulin domain Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
T-helper 1 type immune response	ISS	GO_REF
T-helper 1 type immune response	ISO	GO_REF
T-helper 1 type immune response	IBA	GO_REF
T-helper 1 type immune response	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

T-helper 1 type immune response

response to stimulus [inference]

immune response [inference]

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

T-helper 1 type immune response

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 4** entries
GO Term	Evidence Code	Reference
interleukin-18 binding	ISS	GO_REF
interleukin-18 binding	ISO	GO_REF
interleukin-18 binding	IBA	GO_REF
interleukin-18 binding	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

cytokine binding [inference]

interleukin-18 binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MTMRHCWTAGPSSWWVLLLYVHVILARATSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
74	N-linked (GlcNAc...) asparagine	UniProt
98	N-linked (GlcNAc...) asparagine	UniProt
120	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
142	N-linked (GlcNAc...) asparagine	UniProt