GlyCosmos Portal

Submissions

P2X purinoceptor 7

Summary

UniProt ID: Q9Z1M0
Gene Symbol: P2rx7 P2x7
Gene ID: 18439
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB

GPDB0007842

GlyConnect

P2X purinoceptor 7

GlyGen

Q9Z1M0

PubChem

Q9Z1M0

Re-Glyco

Q9Z1M0

Annotation

Keyword: ADP-ribosylation ATP-binding Cell membrane Disulfide bond GTP-binding Glycoprotein Ligand-gated ion channel Metal-binding Palmitate Phosphoprotein Receptor Reference proteome Sodium Transmembrane helix Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of **105** in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
cell morphogenesis	IMP	PMID
positive regulation of cytokine production	IMP	PMID
phagolysosome assembly	IMP	PMID
positive regulation of T cell mediated cytotoxicity	IMP	PMID
regulation of sodium ion transport	ISO	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte homeostasis [inference]

lymphocyte homeostasis [inference]

T cell homeostasis

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

T cell proliferation

lymphocyte proliferation [inference]

T cell proliferation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

T cell proliferation

lymphocyte proliferation [inference]

T cell proliferation

signal transduction [inference]

cell surface receptor signaling pathway

apoptotic signaling pathway

extrinsic apoptotic signaling pathway

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

sphingolipid biosynthetic process [inference]

ceramide biosynthetic process

macromolecule biosynthetic process [inference]

gene expression

collagen metabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

macromolecule biosynthetic process [inference]

gene expression

protein metabolic process [inference]

proteolysis [inference]

protein processing

membrane protein proteolysis [inference]

membrane protein ectodomain proteolysis

protein catabolic process

protein maturation [inference]

protein processing

primary metabolic process [inference]

lipid metabolic process [inference]

sphingolipid metabolic process [inference]

ceramide metabolic process [inference]

ceramide biosynthetic process

sphingolipid biosynthetic process [inference]

ceramide biosynthetic process

lipid biosynthetic process [inference]

sphingolipid biosynthetic process [inference]

ceramide biosynthetic process

protein metabolic process [inference]

proteolysis [inference]

protein processing

membrane protein proteolysis [inference]

membrane protein ectodomain proteolysis

protein catabolic process

protein maturation [inference]

protein processing

reactive oxygen species metabolic process

cell death [inference]

programmed cell death

cell population proliferation [inference]

leukocyte proliferation [inference]

mononuclear cell proliferation [inference]

lymphocyte proliferation [inference]

T cell proliferation

intercellular transport [inference]

release of sequestered calcium ion into cytosol

vesicle-mediated transport [inference]

exocytosis [inference]

regulated exocytosis [inference]

synaptic vesicle exocytosis

vesicle-mediated transport in synapse [inference]

synaptic vesicle exocytosis

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to dsRNA

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

mitochondrion organization

vacuole organization [inference]

lytic vacuole organization [inference]

lysosome organization [inference]

phagolysosome assembly

vesicle organization [inference]

organelle assembly [inference]

phagolysosome assembly

cellular component assembly [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

bleb assembly

protein-containing complex assembly [inference]

pore complex assembly

protein complex oligomerization [inference]

protein homooligomerization [inference]

protein homotrimerization

protein trimerization [inference]

protein homotrimerization

organelle assembly [inference]

phagolysosome assembly

cell projection organization [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

bleb assembly

plasma membrane bounded cell projection organization [inference]

plasma membrane bounded cell projection assembly [inference]

bleb assembly

regulation of cellular component size [inference]

regulation of cell size [inference]

cell volume homeostasis

negative regulation of cell volume

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

pore complex assembly

protein complex oligomerization [inference]

protein homooligomerization [inference]

protein homotrimerization

protein trimerization [inference]

protein homotrimerization

membrane organization [inference]

vesicle budding from membrane

plasma membrane organization

plasma membrane phospholipid scrambling

regulation of membrane lipid distribution [inference]

lipid translocation [inference]

phospholipid translocation

plasma membrane phospholipid scrambling

export from cell [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

synaptic vesicle exocytosis

signal release [inference]

signal release from synapse [inference]

synaptic vesicle exocytosis

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

T cell proliferation

lymphocyte proliferation [inference]

T cell proliferation

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of pain

multicellular organismal-level homeostasis [inference]

homeostasis of number of cells [inference]

leukocyte homeostasis [inference]

lymphocyte homeostasis [inference]

T cell homeostasis

homeostasis of number of cells within a tissue

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

homeostasis of number of cells within a tissue

developmental process [inference]

anatomical structure morphogenesis [inference]

cell morphogenesis

animal organ morphogenesis [inference]

skeletal system morphogenesis

homeostatic process [inference]

cellular homeostasis [inference]

cell volume homeostasis

negative regulation of cell volume

multicellular organismal-level homeostasis [inference]

homeostasis of number of cells [inference]

leukocyte homeostasis [inference]

lymphocyte homeostasis [inference]

T cell homeostasis

homeostasis of number of cells within a tissue

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

homeostasis of number of cells within a tissue

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium

defense response to bacterium [inference]

defense response to Gram-positive bacterium

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response

defense response to bacterium [inference]

defense response to Gram-positive bacterium

response to fluid shear stress

response to external stimulus [inference]

response to mechanical stimulus

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to other organism [inference]

response to bacterium

defense response to bacterium [inference]

defense response to Gram-positive bacterium

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to other organism [inference]

response to bacterium

defense response to bacterium [inference]

defense response to Gram-positive bacterium

response to abiotic stimulus [inference]

response to chemical [inference]

response to xenobiotic stimulus

response to metal ion [inference]

response to lipid [inference]

response to lipopolysaccharide

response to organophosphorus [inference]

response to ATP

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to dsRNA

response to nitrogen compound [inference]

response to purine-containing compound [inference]

response to ATP

response to dsRNA [inference]

cellular response to dsRNA

cellular response to nitrogen compound [inference]

cellular response to dsRNA

response to oxygen-containing compound [inference]

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to dsRNA

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport

metal ion transport [inference]

calcium ion transport

calcium ion transmembrane transport

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol

lipid transport [inference]

phospholipid transport [inference]

phospholipid transfer to membrane

phospholipid translocation

plasma membrane phospholipid scrambling

lipid translocation [inference]

phospholipid translocation

plasma membrane phospholipid scrambling

intercellular transport [inference]

release of sequestered calcium ion into cytosol

organophosphate ester transport [inference]

nucleotide transport [inference]

purine nucleotide transport [inference]

purine ribonucleotide transport [inference]

ATP transport [inference]

ATP export

adenine nucleotide transport [inference]

ATP transport [inference]

ATP export

NAD transport

phospholipid transport [inference]

phospholipid transfer to membrane

phospholipid translocation

plasma membrane phospholipid scrambling

vesicle-mediated transport [inference]

exocytosis [inference]

regulated exocytosis [inference]

synaptic vesicle exocytosis

vesicle-mediated transport in synapse [inference]

synaptic vesicle exocytosis

secretion [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

synaptic vesicle exocytosis

signal release [inference]

signal release from synapse [inference]

synaptic vesicle exocytosis

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol

nitrogen compound transport [inference]

nucleobase-containing compound transport [inference]

nucleotide transport [inference]

purine nucleotide transport [inference]

purine ribonucleotide transport [inference]

ATP transport [inference]

ATP export

adenine nucleotide transport [inference]

ATP transport [inference]

ATP export

NAD transport

export from cell [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

synaptic vesicle exocytosis

signal release [inference]

signal release from synapse [inference]

synaptic vesicle exocytosis

carbohydrate derivative transport [inference]

purine ribonucleotide transport [inference]

ATP transport [inference]

ATP export

establishment of localization in cell [inference]

synaptic vesicle exocytosis

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of leukocyte mediated immunity [inference]

regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of lymphocyte mediated immunity [inference]

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of immune response [inference]

regulation of adaptive immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

presynaptic modulation of chemical synaptic transmission [inference]

regulation of presynaptic dense core granule exocytosis

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

regulation of transport [inference]

regulation of lipid transport [inference]

positive regulation of lipid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

regulation of fatty acid transport [inference]

regulation of icosanoid secretion [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

regulation of prostaglandin secretion [inference]

positive regulation of prostaglandin secretion

positive regulation of fatty acid transport [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

regulation of organic acid transport [inference]

regulation of glutamate secretion [inference]

positive regulation of glutamate secretion

regulation of gamma-aminobutyric acid secretion [inference]

positive regulation of gamma-aminobutyric acid secretion

positive regulation of organic acid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

regulation of fatty acid transport [inference]

regulation of icosanoid secretion [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

regulation of prostaglandin secretion [inference]

positive regulation of prostaglandin secretion

positive regulation of fatty acid transport [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

regulation of transmembrane transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of calcium ion transport into cytosol [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of sodium ion transport

regulation of calcium ion transport [inference]

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

regulation of calcium ion transmembrane transport [inference]

regulation of calcium ion transport into cytosol [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of calcium ion transport into cytosol [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of monoatomic ion transport [inference]

positive regulation of monoatomic ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

regulation of secretion [inference]

regulation of gamma-aminobutyric acid secretion [inference]

positive regulation of gamma-aminobutyric acid secretion

regulation of icosanoid secretion [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

regulation of prostaglandin secretion [inference]

positive regulation of prostaglandin secretion

positive regulation of secretion [inference]

positive regulation of gamma-aminobutyric acid secretion

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

positive regulation of secretion by cell [inference]

regulation of secretion by cell [inference]

regulation of glutamate secretion [inference]

positive regulation of glutamate secretion

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of calcium ion-dependent exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of dense core granule exocytosis [inference]

regulation of presynaptic dense core granule exocytosis

regulation of synaptic vesicle exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of prostaglandin secretion [inference]

positive regulation of prostaglandin secretion

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of secretion by cell [inference]

positive regulation of transport [inference]

positive regulation of lipid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

positive regulation of organic acid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of monoatomic ion transport [inference]

positive regulation of monoatomic ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of secretion [inference]

positive regulation of gamma-aminobutyric acid secretion

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

positive regulation of secretion by cell [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of amine transport [inference]

positive regulation of amino acid transport [inference]

regulation of protein transport [inference]

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of protein transport [inference]

positive regulation of protein secretion

regulation of neurotransmitter transport [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of amine transport [inference]

positive regulation of amine transport [inference]

positive regulation of amino acid transport [inference]

regulation of amino acid transport [inference]

regulation of glutamate secretion [inference]

positive regulation of glutamate secretion

regulation of gamma-aminobutyric acid secretion [inference]

positive regulation of gamma-aminobutyric acid secretion

positive regulation of amino acid transport [inference]

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of calcium ion-dependent exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of dense core granule exocytosis [inference]

regulation of presynaptic dense core granule exocytosis

regulation of synaptic vesicle exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of cellular localization [inference]

regulation of calcium ion transport into cytosol [inference]

positive regulation of calcium ion transport into cytosol

regulation of lipid localization [inference]

regulation of lipid transport [inference]

positive regulation of lipid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

regulation of fatty acid transport [inference]

regulation of icosanoid secretion [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

regulation of prostaglandin secretion [inference]

positive regulation of prostaglandin secretion

positive regulation of fatty acid transport [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

positive regulation of lipid localization [inference]

positive regulation of lipid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

positive regulation of catabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of phosphorus metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

positive regulation of carbohydrate metabolic process [inference]

positive regulation of glycolytic process

positive regulation of small molecule metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of leukocyte apoptotic process [inference]

positive regulation of lymphocyte apoptotic process

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of NLRP3 inflammasome complex assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of bleb assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization

positive regulation of protein-containing complex assembly [inference]

positive regulation of NLRP3 inflammasome complex assembly

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of bleb assembly

positive regulation of secretion by cell [inference]

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of transport [inference]

positive regulation of lipid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

positive regulation of organic acid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of monoatomic ion transport [inference]

positive regulation of monoatomic ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of secretion [inference]

positive regulation of gamma-aminobutyric acid secretion

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

positive regulation of secretion by cell [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of amine transport [inference]

positive regulation of amino acid transport [inference]

positive regulation of developmental process [inference]

positive regulation of biomineral tissue development [inference]

positive regulation of bone mineralization

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

positive regulation of ossification

positive regulation of bone mineralization

positive regulation of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of membrane depolarization [inference]

positive regulation of mitochondrial depolarization

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of protein secretion

positive regulation of lipid localization [inference]

positive regulation of lipid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of icosanoid secretion [inference]

positive regulation of prostaglandin secretion

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of multicellular organismal process [inference]

negative regulation of tissue remodeling [inference]

negative regulation of bone remodeling [inference]

negative regulation of bone resorption

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of immune response [inference]

regulation of adaptive immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of developmental process [inference]

positive regulation of developmental process [inference]

positive regulation of biomineral tissue development [inference]

positive regulation of bone mineralization

regulation of multicellular organismal development [inference]

regulation of biomineral tissue development [inference]

regulation of bone mineralization [inference]

positive regulation of bone mineralization

positive regulation of biomineral tissue development [inference]

positive regulation of bone mineralization

regulation of cellular process [inference]

regulation of membrane depolarization [inference]

regulation of mitochondrial depolarization [inference]

positive regulation of mitochondrial depolarization

positive regulation of membrane depolarization [inference]

positive regulation of mitochondrial depolarization

signal transduction [inference]

cell surface receptor signaling pathway

apoptotic signaling pathway

extrinsic apoptotic signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

presynaptic modulation of chemical synaptic transmission [inference]

regulation of presynaptic dense core granule exocytosis

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 alpha production [inference]

positive regulation of interleukin-1 alpha production

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

positive regulation of catabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of phosphorus metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

positive regulation of carbohydrate metabolic process [inference]

positive regulation of glycolytic process

positive regulation of small molecule metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

regulation of nucleotide catabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

regulation of carbohydrate catabolic process [inference]

regulation of glycolytic process [inference]

positive regulation of glycolytic process

regulation of generation of precursor metabolites and energy [inference]

regulation of glycolytic process [inference]

positive regulation of glycolytic process

regulation of phosphorus metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide catabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

regulation of ATP metabolic process [inference]

regulation of glycolytic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

positive regulation of phosphorus metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 alpha production [inference]

positive regulation of interleukin-1 alpha production

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

regulation of small molecule metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide catabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

regulation of ATP metabolic process [inference]

regulation of glycolytic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

positive regulation of small molecule metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

regulation of primary metabolic process [inference]

regulation of carbohydrate metabolic process [inference]

regulation of carbohydrate catabolic process [inference]

regulation of glycolytic process [inference]

positive regulation of glycolytic process

positive regulation of carbohydrate metabolic process [inference]

positive regulation of glycolytic process

regulation of nucleobase-containing compound metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide catabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

regulation of ATP metabolic process [inference]

regulation of glycolytic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

regulation of cell killing [inference]

regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of transmembrane transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of calcium ion transport into cytosol [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

positive regulation of leukocyte apoptotic process [inference]

positive regulation of lymphocyte apoptotic process

regulation of leukocyte apoptotic process [inference]

regulation of lymphocyte apoptotic process [inference]

positive regulation of lymphocyte apoptotic process

positive regulation of leukocyte apoptotic process [inference]

positive regulation of lymphocyte apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of leukocyte apoptotic process [inference]

positive regulation of lymphocyte apoptotic process

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of NLRP3 inflammasome complex assembly

regulation of NLRP3 inflammasome complex assembly [inference]

positive regulation of NLRP3 inflammasome complex assembly

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of NLRP3 inflammasome complex assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of bleb assembly

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of bleb assembly

regulation of bleb assembly [inference]

positive regulation of bleb assembly

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

positive regulation of catabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of phosphorus metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

positive regulation of carbohydrate metabolic process [inference]

positive regulation of glycolytic process

positive regulation of small molecule metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide catabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide catabolic process [inference]

positive regulation of glycolytic process

positive regulation of ATP metabolic process [inference]

positive regulation of glycolytic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of leukocyte apoptotic process [inference]

positive regulation of lymphocyte apoptotic process

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of NLRP3 inflammasome complex assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of bleb assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization

positive regulation of protein-containing complex assembly [inference]

positive regulation of NLRP3 inflammasome complex assembly

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of bleb assembly

positive regulation of secretion by cell [inference]

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of bleb assembly

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of bleb assembly

regulation of bleb assembly [inference]

positive regulation of bleb assembly

regulation of plasma membrane bounded cell projection organization [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of bleb assembly

regulation of bleb assembly [inference]

positive regulation of bleb assembly

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization

regulation of cytoskeleton organization [inference]

positive regulation of cytoskeleton organization

regulation of protein-containing complex assembly [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of NLRP3 inflammasome complex assembly

regulation of NLRP3 inflammasome complex assembly [inference]

positive regulation of NLRP3 inflammasome complex assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization

positive regulation of protein-containing complex assembly [inference]

positive regulation of NLRP3 inflammasome complex assembly

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of bleb assembly

regulation of cellular localization [inference]

regulation of calcium ion transport into cytosol [inference]

positive regulation of calcium ion transport into cytosol

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of calcium ion-dependent exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of dense core granule exocytosis [inference]

regulation of presynaptic dense core granule exocytosis

regulation of synaptic vesicle exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of secretion by cell [inference]

regulation of glutamate secretion [inference]

positive regulation of glutamate secretion

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of calcium ion-dependent exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of dense core granule exocytosis [inference]

regulation of presynaptic dense core granule exocytosis

regulation of synaptic vesicle exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of prostaglandin secretion [inference]

positive regulation of prostaglandin secretion

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of protein secretion [inference]

positive regulation of protein secretion

positive regulation of secretion by cell [inference]

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 alpha production [inference]

positive regulation of interleukin-1 alpha production

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

regulation of ossification [inference]

regulation of bone mineralization [inference]

positive regulation of bone mineralization

positive regulation of ossification

positive regulation of bone mineralization

regulation of tissue remodeling [inference]

negative regulation of tissue remodeling [inference]

negative regulation of bone remodeling [inference]

negative regulation of bone resorption

regulation of bone remodeling [inference]

regulation of bone resorption [inference]

negative regulation of bone resorption

negative regulation of bone remodeling [inference]

negative regulation of bone resorption

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-6 production

positive regulation of ossification

positive regulation of bone mineralization

negative regulation of multicellular organismal process [inference]

negative regulation of tissue remodeling [inference]

negative regulation of bone remodeling [inference]

negative regulation of bone resorption

regulation of multicellular organismal development [inference]

regulation of biomineral tissue development [inference]

regulation of bone mineralization [inference]

positive regulation of bone mineralization

positive regulation of biomineral tissue development [inference]

positive regulation of bone mineralization

regulation of biological quality [inference]

positive regulation of cytosolic calcium ion concentration [inference]

positive regulation of calcium ion transport into cytosol

regulation of calcium ion transport into cytosol [inference]

positive regulation of calcium ion transport into cytosol

regulation of membrane potential [inference]

action potential [inference]

neuronal action potential

regulation of membrane depolarization [inference]

regulation of mitochondrial depolarization [inference]

positive regulation of mitochondrial depolarization

positive regulation of membrane depolarization [inference]

positive regulation of mitochondrial depolarization

regulation of mitochondrial membrane potential [inference]

regulation of mitochondrial depolarization [inference]

positive regulation of mitochondrial depolarization

membrane depolarization

regulation of anatomical structure size [inference]

regulation of cellular component size [inference]

regulation of cell size [inference]

cell volume homeostasis

negative regulation of cell volume

regulation of membrane lipid distribution [inference]

lipid translocation [inference]

phospholipid translocation

plasma membrane phospholipid scrambling

Displaying entries **1 - 5** of 23 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
nuclear envelope	ISO	GO_REF
cytoplasm	ISO	GO_REF
plasma membrane	ISS	PMID GO_REF
plasma membrane	ISO	GO_REF GO_REF
plasma membrane	TAS	Reactome Reactome

GO Hierarchy

cellular component

protein-containing complex

cellular anatomical structure [inference]

cytoplasm

membrane

plasma membrane

cell junction [inference]

synapse

neuromuscular junction

anchoring junction [inference]

cell-cell junction

organelle envelope [inference]

nuclear envelope

cell projection [inference]

plasma membrane bounded cell projection [inference]

bleb

cell body [inference]

neuronal cell body

side of membrane [inference]

external side of plasma membrane

presynapse [inference]

terminal bouton

postsynapse

Displaying entries **1 - 5** of 27 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
magnesium ion binding	ISO	GO_REF
lipopolysaccharide binding	IDA	PMID
purinergic nucleotide receptor activity	ISO	GO_REF GO_REF
purinergic nucleotide receptor activity	IEA	GO_REF GO_REF
extracellularly ATP-gated monoatomic cation channel activity	ISO	GO_REF GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity [inference]

ligand-gated monoatomic cation channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

ligand-gated monoatomic ion channel activity [inference]

extracellular ligand-gated monoatomic ion channel activity [inference]

excitatory extracellular ligand-gated monoatomic ion channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

ligand-gated monoatomic cation channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

monoatomic cation transmembrane transporter activity [inference]

monoatomic cation channel activity [inference]

ligand-gated monoatomic cation channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

metal ion transmembrane transporter activity [inference]

potassium ion transmembrane transporter activity [inference]

potassium channel activity

sodium ion transmembrane transporter activity [inference]

sodium channel activity

passive transmembrane transporter activity [inference]

channel activity

monoatomic ion channel activity [inference]

monoatomic cation channel activity [inference]

ligand-gated monoatomic cation channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

ligand-gated monoatomic ion channel activity [inference]

extracellular ligand-gated monoatomic ion channel activity [inference]

excitatory extracellular ligand-gated monoatomic ion channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

ligand-gated monoatomic cation channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

gated channel activity [inference]

ligand-gated channel activity [inference]

ligand-gated monoatomic ion channel activity [inference]

extracellular ligand-gated monoatomic ion channel activity [inference]

excitatory extracellular ligand-gated monoatomic ion channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

ligand-gated monoatomic cation channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

ATP-gated ion channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

binding [inference]

protein binding [inference]

lipid binding [inference]

lipopolysaccharide binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

cation binding [inference]

metal ion binding [inference]

magnesium ion binding

transition metal ion binding [inference]

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

carbohydrate derivative binding [inference]

lipopolysaccharide binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

guanyl ribonucleotide binding [inference]

GTP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

molecular transducer activity [inference]

signaling receptor activity

transmembrane signaling receptor activity [inference]

nucleotide receptor activity [inference]

purinergic nucleotide receptor activity

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein serine/threonine kinase activator activity

kinase regulator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein serine/threonine kinase activator activity

protein kinase regulator activity [inference]

protein kinase activator activity [inference]

protein serine/threonine kinase activator activity

molecular function activator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein serine/threonine kinase activator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPACCSWNDVLQYETNKVTRIQSTNYGTVKWVLHMIVFSYISFALVSDKLYQRKEPVISSVHTKVKGIAEVTENVTEGGVTKLGHSIFDTADYTFPLQGNSFFVMTNYVKSEGQVQTLCPEYPRRGAQCSSDRRCKKGWMDPQSKGIQTGRCVPYDKTRKTCEVSAWCPTEEEKEAPRPALLRSAENFTVLIKNNIHFPGHNYTTRNILPTMNGSCTFHKTWDPQCSIFRLGDIFQEAGENFTEVAVQGGIMGIEIYWDCNLDSWSHHCRPRYSFRRLDDKNTDESFVPGYNFRYAKYYKENNVEKRTLIKAFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLATVCIDLLINTYSSAFCRSGVYPYCKCCEPCTVNEYYYRKKCESIMEPKPTLKYVSFVDEPHIRMVDQQLLGKSLQVVKGQEVPRPQMDFSDLSRLSLSLHDSPLTPGQSEEIQLLHEEVAPKSGDSPSWCQCGNCLPSRLPEQRRALEELCCRRKPGRCITTSKLFHKLVLSRDTLQLLLLYQDPLLVLGEEATNSRLRHRAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKTEGQYSGFKYPY

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
74	N-linked (GlcNAc...) asparagine	19349973 30899004	G72747WU G06110VR G66538GV	GlycoProtDB UniProt GlyGen GlyConnect
187	N-linked (GlcNAc...) asparagine		G80920RR	GlycoProtDB UniProt GlyGen
202	N-linked (GlcNAc...) asparagine	30899004	G70101JE G80920RR G64527OM G05724UK	GlycoProtDB UniProt GlyGen GlyConnect
213	N-linked (GlcNAc...) asparagine	30899004	G24748EV G06110VR	GlycoProtDB UniProt GlyGen GlyConnect
241	N-linked (GlcNAc...) asparagine			UniProt GlyGen