GlyCosmos Portal

Submissions

C-type lectin domain family 4 member D

Summary

UniProt ID: Q9Z2H6
Gene Symbol: Clec4d Clecsf8 Mcl
Gene ID: 17474
Organism: Mus musculus (house mouse)

External Links

PubChem: Q9Z2H6
Re-Glyco: Q9Z2H6

Annotation

Keyword: Adaptive immunity Calcium Cell membrane Disulfide bond Glycoprotein Innate immunity Lectin Metal-binding Receptor Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
adaptive immune response	IMP	PMID
T cell differentiation involved in immune response	IMP	PMID
positive regulation of myeloid dendritic cell activation	IMP	PMID
Fc-gamma receptor signaling pathway	IDA	PMID
defense response to bacterium	IMP	PMID

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

cell activation involved in immune response [inference]

leukocyte activation involved in immune response [inference]

lymphocyte activation involved in immune response [inference]

T cell activation involved in immune response [inference]

T cell differentiation involved in immune response

immune response [inference]

adaptive immune response

innate immune response

antifungal innate immune response

leukocyte activation [inference]

leukocyte activation involved in immune response [inference]

lymphocyte activation involved in immune response [inference]

T cell activation involved in immune response [inference]

T cell differentiation involved in immune response

lymphocyte activation [inference]

lymphocyte activation involved in immune response [inference]

T cell activation involved in immune response [inference]

T cell differentiation involved in immune response

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation involved in immune response

T cell activation [inference]

T cell activation involved in immune response [inference]

T cell differentiation involved in immune response

T cell differentiation [inference]

T cell differentiation involved in immune response

cellular process [inference]

cell activation [inference]

cell activation involved in immune response [inference]

leukocyte activation involved in immune response [inference]

lymphocyte activation involved in immune response [inference]

T cell activation involved in immune response [inference]

T cell differentiation involved in immune response

leukocyte activation [inference]

leukocyte activation involved in immune response [inference]

lymphocyte activation involved in immune response [inference]

T cell activation involved in immune response [inference]

T cell differentiation involved in immune response

lymphocyte activation [inference]

lymphocyte activation involved in immune response [inference]

T cell activation involved in immune response [inference]

T cell differentiation involved in immune response

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation involved in immune response

T cell activation [inference]

T cell activation involved in immune response [inference]

T cell differentiation involved in immune response

T cell differentiation [inference]

T cell differentiation involved in immune response

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

Fc receptor signaling pathway [inference]

Fc-gamma receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

Fc receptor signaling pathway [inference]

Fc-gamma receptor signaling pathway

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation involved in immune response

multicellular organismal process [inference]

cell activation [inference]

cell activation involved in immune response [inference]

leukocyte activation involved in immune response [inference]

lymphocyte activation involved in immune response [inference]

T cell activation involved in immune response [inference]

T cell differentiation involved in immune response

leukocyte activation [inference]

leukocyte activation involved in immune response [inference]

lymphocyte activation involved in immune response [inference]

T cell activation involved in immune response [inference]

T cell differentiation involved in immune response

lymphocyte activation [inference]

lymphocyte activation involved in immune response [inference]

T cell activation involved in immune response [inference]

T cell differentiation involved in immune response

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation involved in immune response

T cell activation [inference]

T cell activation involved in immune response [inference]

T cell differentiation involved in immune response

T cell differentiation [inference]

T cell differentiation involved in immune response

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation involved in immune response

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

response to fungus [inference]

defense response to fungus [inference]

antifungal innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

antifungal innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to bacterium

defense response to fungus [inference]

antifungal innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

antifungal innate immune response

immune response [inference]

adaptive immune response

innate immune response

antifungal innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

response to fungus [inference]

defense response to fungus [inference]

antifungal innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

antifungal innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

response to fungus [inference]

defense response to fungus [inference]

antifungal innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

antifungal innate immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of myeloid dendritic cell activation

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of myeloid dendritic cell activation

regulation of myeloid dendritic cell activation [inference]

positive regulation of myeloid dendritic cell activation

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

Fc receptor signaling pathway [inference]

Fc-gamma receptor signaling pathway

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of myeloid dendritic cell activation

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of myeloid dendritic cell activation

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of myeloid dendritic cell activation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

Fc receptor signaling pathway [inference]

Fc-gamma receptor signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

Fc receptor signaling pathway [inference]

Fc-gamma receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

Fc receptor signaling pathway [inference]

Fc-gamma receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of myeloid dendritic cell activation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of myeloid dendritic cell activation

regulation of myeloid dendritic cell activation [inference]

positive regulation of myeloid dendritic cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of myeloid dendritic cell activation

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of myeloid dendritic cell activation

regulation of myeloid dendritic cell activation [inference]

positive regulation of myeloid dendritic cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of myeloid dendritic cell activation

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of myeloid dendritic cell activation

Displaying **all 4** entries
GO Term	Evidence Code	Reference
plasma membrane	ISO	GO_REF
plasma membrane	IDA	PMID
plasma membrane	IEA	GO_REF GO_REF
external side of plasma membrane	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
D-mannose binding	ISS	GO_REF
D-mannose binding	ISO	GO_REF
D-mannose binding	IEA	GO_REF
carbohydrate binding	IBA	GO_REF
immunoglobulin receptor binding	IPI	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

immunoglobulin receptor binding

carbohydrate binding

monosaccharide binding [inference]

D-mannose binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

monosaccharide binding [inference]

D-mannose binding

molecular transducer activity [inference]

signaling receptor activity [inference]

pattern recognition receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MWLEESQMKSKGTRHPQLIPCVFAVVSISFLSACFISTCLVTHHYFLRWTRGSVVKLSDYHTRVTCIREEPQPGATGGTWTCCPVSWRAFQSNCYFPLNDNQTWHESERNCSGMSSHLVTINTEAEQNFVTQLLDKRFSYFLGLADENVEGQWQWVDKTPFNPHTVFWEKGESNDFMEEDCVVLVHVHEKWVWNDFPCHFEVRRICKLPGITFNWKPSK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
101	N-linked (GlcNAc...) asparagine			UniProt
110	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Dectin-2 family	Mus musculus
Neutrophil degranulation	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements