GlyCosmos Portal

Submissions

Protein adenylyltransferase FICD

Summary

UniProt ID: U3K2P1
Gene Symbol: FICD
Gene ID: 101820952
Organism: Ficedula albicollis (Collared flycatcher)

External Links

Re-Glyco: U3K2P1

Annotation

Keyword: ATP-binding Endoplasmic reticulum Glycoprotein Hydrolase Magnesium Manganese Nucleotidyltransferase Reference proteome Repeat Signal-anchor TPR repeat Transmembrane helix Unfolded protein response

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
response to unfolded protein
response to endoplasmic reticulum stress	IEA	GO_REF
regulation of IRE1-mediated unfolded protein response	IEA	GO_REF GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress

response to topologically incorrect protein [inference]

response to unfolded protein

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of endoplasmic reticulum unfolded protein response [inference]

regulation of IRE1-mediated unfolded protein response

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of endoplasmic reticulum unfolded protein response [inference]

regulation of IRE1-mediated unfolded protein response

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of response to endoplasmic reticulum stress [inference]

regulation of endoplasmic reticulum unfolded protein response [inference]

regulation of IRE1-mediated unfolded protein response

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of endoplasmic reticulum unfolded protein response [inference]

regulation of IRE1-mediated unfolded protein response

regulation of cellular response to stress [inference]

regulation of response to endoplasmic reticulum stress [inference]

regulation of endoplasmic reticulum unfolded protein response [inference]

regulation of IRE1-mediated unfolded protein response

Displaying 1 entry
GO Term	Evidence Code	Reference
endoplasmic reticulum membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

Displaying **all 5** entries
GO Term	Evidence Code	Reference
ATP binding	IEA	GO_REF
Hsp70 protein binding	IEA	GO_REF GO_REF
protein homodimerization activity	IEA	GO_REF
protein adenylylhydrolase activity	IEA	GO_REF GO_REF
AMPylase activity	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

nucleotidyltransferase activity [inference]

adenylyltransferase activity [inference]

AMPylase activity

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

phosphoric ester hydrolase activity [inference]

phosphoric diester hydrolase activity [inference]

protein adenylylhydrolase activity

catalytic activity, acting on a protein [inference]

protein adenylylhydrolase activity

binding [inference]

protein binding [inference]

heat shock protein binding [inference]

Hsp70 protein binding

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

protein-folding chaperone binding [inference]

Hsp70 protein binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MFPGGSSGKGDAPGVRAGSRMNLVAMATDPELQWVSLWLRVRWAAVLVLLLSSLVMLLLPLAAVDNQCHAVLKGLSFLRSKLGSSGISRLTGQSTELSVTSQGLELLVLKGKASPEVKLEARAALNQALEMKRQGKREKAHKLFLYALKMDPDYVDALNEFGIFSEEDKDILQADYLYSKALTISPHNEKALSNRGRTLPLVEEIDQRYFSIIDSKVKKVMAIPKGNSALRRVMEESYYHHIYHTVAIEGNTLTLSEIRHIIETRYAVPGKSLTEQNEVIGMHAALKFVNTTLVSRIGSVTSRDILDIHRRVLGYADPVEAGRFRATQVFVGHHIPPHPQDVEKQMEEFVQWMNSEDAMSLHPVEFAALAHYKLVYIHPFVDGNGRTSRLLMNLILMQAGYPPITIRKEQRAEYYHVLEVANEGDVRPFIRFIAKCAETTLDMLLIATTEVSVGLPEAGGSAGCKQTIPVKT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites