GlyCosmos Portal

Submissions

Sodium/hydrogen exchanger 6

Summary

UniProt ID: A1L3P4
Gene Symbol: Nhe6 Slc9a6
Gene ID: 236794
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0001581
Re-Glyco: A1L3P4

Annotation

Keyword: Cell membrane Endosome Reference proteome Sodium transport Transmembrane helix Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 21 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
establishment of cell polarity	ISS	GO_REF
establishment of cell polarity	ISO	GO_REF
brain-derived neurotrophic factor receptor signaling pathway	IMP	PMID
axon extension	ISO	PMID
neuron projection morphogenesis	ISO	PMID

GO Hierarchy

biological process

cellular process [inference]

cell activation [inference]

glial cell activation

establishment or maintenance of cell polarity [inference]

establishment of cell polarity

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

brain-derived neurotrophic factor receptor signaling pathway

cell growth [inference]

developmental cell growth [inference]

neuron projection extension [inference]

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport [inference]

sodium ion import across plasma membrane

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

sodium ion import across plasma membrane

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis

cell junction organization [inference]

synapse organization

multicellular organismal process [inference]

cell activation [inference]

glial cell activation

developmental process [inference]

anatomical structure morphogenesis [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis

anatomical structure development [inference]

dendritic spine development

growth [inference]

cell growth [inference]

developmental cell growth [inference]

neuron projection extension [inference]

developmental growth [inference]

developmental cell growth [inference]

neuron projection extension [inference]

developmental growth involved in morphogenesis [inference]

neuron projection extension [inference]

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH

monoatomic cation homeostasis [inference]

regulation of pH [inference]

regulation of intracellular pH

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport [inference]

potassium ion transport [inference]

potassium ion transmembrane transport

sodium ion transport [inference]

sodium ion transmembrane transport [inference]

sodium ion import across plasma membrane

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport [inference]

sodium ion import across plasma membrane

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport [inference]

sodium ion import across plasma membrane

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport [inference]

sodium ion import across plasma membrane

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

sodium ion import across plasma membrane

import into cell [inference]

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

sodium ion import across plasma membrane

biological regulation [inference]

regulation of pH [inference]

regulation of intracellular pH

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of neurotrophin TRK receptor signaling pathway

regulation of localization [inference]

regulation of transport [inference]

regulation of transmembrane transport [inference]

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of proton transport [inference]

regulation of synaptic vesicle lumen acidification

regulation of monoatomic ion transport [inference]

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of proton transport [inference]

regulation of synaptic vesicle lumen acidification

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of neurotrophin TRK receptor signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of neurotrophin TRK receptor signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

brain-derived neurotrophic factor receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of neurotrophin TRK receptor signaling pathway

regulation of transmembrane transport [inference]

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of proton transport [inference]

regulation of synaptic vesicle lumen acidification

regulation of biological quality [inference]

Displaying entries **1 - 5** of 34 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	HDA	PMID
endosome	IDA	PMID
early endosome	IDA	PMID
late endosome	IDA	PMID
endoplasmic reticulum membrane	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

endoplasmic reticulum membrane

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane [inference]

bounding membrane of organelle [inference]

endosome membrane [inference]

cell junction [inference]

synapse

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

dendrite

neuron spine [inference]

axonal spine

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle

endosome

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular vesicle [inference]

cytoplasmic vesicle

endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular vesicle [inference]

cytoplasmic vesicle

endosome

neuron projection terminus [inference]

axon terminus

presynapse

axon terminus

Displaying **all 4** entries
GO Term	Evidence Code	Reference
sodium:proton antiporter activity	IDA	PMID
sodium:proton antiporter activity	IEA	GO_REF
potassium:proton antiporter activity	IDA	PMID
identical protein binding	ISO	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

proton transmembrane transporter activity [inference]

metal cation:proton antiporter activity [inference]

metal ion transmembrane transporter activity [inference]

potassium ion transmembrane transporter activity [inference]

solute:potassium antiporter activity [inference]

potassium:proton antiporter activity

sodium ion transmembrane transporter activity [inference]

sodium:proton antiporter activity

metal cation:monoatomic cation antiporter activity [inference]

solute:potassium antiporter activity [inference]

potassium:proton antiporter activity

metal cation:proton antiporter activity [inference]

active transmembrane transporter activity [inference]

secondary active transmembrane transporter activity [inference]

antiporter activity [inference]

metal cation:monoatomic cation antiporter activity [inference]

solute:potassium antiporter activity [inference]

potassium:proton antiporter activity

metal cation:proton antiporter activity [inference]

binding [inference]

protein binding [inference]

identical protein binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAGARRGWRLAPVRRGVCGPRARPLMRPLWLLFAVSFFGWTGALDGSGGTTRAMDEEIVSEKQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGLLVGLVLRYGIHVPSDVNNVTLSCEVQSSPTTLLVNVSGKFYEYTLKGEISSHELNNVQDNEMLRKVTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSILAYAFLGTAISCFVIGSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFSGSFAMGAATGVVTALVTKFTKLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFIAIFLGRAANIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCLHIRVGVDSDQEHLGVPDNERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILNDGDISLTYGDSTVNTESATASAPRRFMGNSSEDALDRELTFGDHELVIRGTRLVLPMDDSEPALNSLDDTRHSPA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites