GlyCosmos Portal

Submissions

ATP-dependent RNA helicase DDX39A

Summary

UniProt ID: O00148
Gene Symbol: DDX39 DDX39A
Gene ID: 10212
Organism: Homo sapiens (human)

External Links

GlyGen: O00148
PubChem: O00148
The Human Metabolome Database: HMDBP11724
Re-Glyco: O00148

Annotation

Keyword: 3D-structure Acetylation Alternative splicing Cytoplasm Helicase Isopeptide bond Nucleus Phosphoprotein Proteomics identification RNA-binding Reference proteome Ubl conjugation mRNA splicing

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mRNA splicing, via spliceosome	IGI	PMID
mRNA splicing, via spliceosome	IBA	GO_REF
mRNA splicing, via spliceosome	IEA	GO_REF
RNA export from nucleus	TAS	Reactome
mRNA export from nucleus	NAS	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing [inference]

mRNA splicing, via spliceosome

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing [inference]

mRNA splicing, via spliceosome

RNA processing [inference]

mRNA processing [inference]

mRNA splicing, via spliceosome

RNA splicing [inference]

RNA splicing, via transesterification reactions [inference]

RNA splicing, via transesterification reactions with bulged adenosine as nucleophile [inference]

mRNA splicing, via spliceosome

intercellular transport [inference]

nuclear export [inference]

RNA export from nucleus

mRNA export from nucleus

cellular localization [inference]

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport [inference]

nuclear export [inference]

RNA export from nucleus

mRNA export from nucleus

localization [inference]

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

nuclear export [inference]

RNA export from nucleus

mRNA export from nucleus

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport [inference]

nuclear export [inference]

RNA export from nucleus

mRNA export from nucleus

nitrogen compound transport [inference]

nucleobase-containing compound transport [inference]

nucleic acid transport [inference]

RNA transport [inference]

RNA export from nucleus

mRNA export from nucleus

mRNA transport [inference]

mRNA export from nucleus

establishment of RNA localization [inference]

RNA transport [inference]

RNA export from nucleus

mRNA export from nucleus

mRNA transport [inference]

mRNA export from nucleus

establishment of localization in cell [inference]

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport [inference]

nuclear export [inference]

RNA export from nucleus

mRNA export from nucleus

cellular localization [inference]

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport [inference]

nuclear export [inference]

RNA export from nucleus

mRNA export from nucleus

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of immune response [inference]

negative regulation of innate immune response

regulation of immune response [inference]

regulation of innate immune response [inference]

negative regulation of innate immune response

negative regulation of immune response [inference]

negative regulation of innate immune response

regulation of localization [inference]

regulation of transport [inference]

regulation of nucleobase-containing compound transport [inference]

negative regulation of nucleobase-containing compound transport [inference]

negative regulation of RNA export from nucleus

regulation of RNA export from nucleus [inference]

negative regulation of RNA export from nucleus

regulation of intracellular transport [inference]

negative regulation of intracellular transport [inference]

negative regulation of nucleocytoplasmic transport [inference]

negative regulation of RNA export from nucleus

regulation of nucleocytoplasmic transport [inference]

negative regulation of nucleocytoplasmic transport [inference]

negative regulation of RNA export from nucleus

regulation of RNA export from nucleus [inference]

negative regulation of RNA export from nucleus

negative regulation of transport [inference]

negative regulation of nucleobase-containing compound transport [inference]

negative regulation of RNA export from nucleus

negative regulation of intracellular transport [inference]

negative regulation of nucleocytoplasmic transport [inference]

negative regulation of RNA export from nucleus

regulation of cellular localization [inference]

regulation of intracellular transport [inference]

negative regulation of intracellular transport [inference]

negative regulation of nucleocytoplasmic transport [inference]

negative regulation of RNA export from nucleus

regulation of nucleocytoplasmic transport [inference]

negative regulation of nucleocytoplasmic transport [inference]

negative regulation of RNA export from nucleus

regulation of RNA export from nucleus [inference]

negative regulation of RNA export from nucleus

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of immune response [inference]

negative regulation of innate immune response

negative regulation of cellular process [inference]

negative regulation of intracellular transport [inference]

negative regulation of nucleocytoplasmic transport [inference]

negative regulation of RNA export from nucleus

negative regulation of response to stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response

negative regulation of defense response [inference]

negative regulation of innate immune response

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response

negative regulation of immune response [inference]

negative regulation of innate immune response

negative regulation of transport [inference]

negative regulation of nucleobase-containing compound transport [inference]

negative regulation of RNA export from nucleus

negative regulation of intracellular transport [inference]

negative regulation of nucleocytoplasmic transport [inference]

negative regulation of RNA export from nucleus

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response

regulation of innate immune response [inference]

negative regulation of innate immune response

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response

regulation of innate immune response [inference]

negative regulation of innate immune response

negative regulation of response to stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response

negative regulation of defense response [inference]

negative regulation of innate immune response

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response

negative regulation of immune response [inference]

negative regulation of innate immune response

regulation of immune response [inference]

regulation of innate immune response [inference]

negative regulation of innate immune response

negative regulation of immune response [inference]

negative regulation of innate immune response

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of innate immune response

regulation of innate immune response [inference]

negative regulation of innate immune response

regulation of cellular process [inference]

negative regulation of cellular process [inference]

negative regulation of intracellular transport [inference]

negative regulation of nucleocytoplasmic transport [inference]

negative regulation of RNA export from nucleus

regulation of cellular localization [inference]

regulation of intracellular transport [inference]

negative regulation of intracellular transport [inference]

negative regulation of nucleocytoplasmic transport [inference]

negative regulation of RNA export from nucleus

regulation of nucleocytoplasmic transport [inference]

negative regulation of nucleocytoplasmic transport [inference]

negative regulation of RNA export from nucleus

regulation of RNA export from nucleus [inference]

negative regulation of RNA export from nucleus

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	EXP	PMID PMID
nucleus	TAS	PMID
nucleus	IDA	PMID PMID
nucleus	IEA	GO_REF GO_REF
nucleoplasm	TAS	Reactome Reactome

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

supramolecular complex [inference]

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
RNA binding	IDA	PMID
RNA binding	HDA	PMID PMID
RNA helicase activity	IEA	GO_REF GO_REF
mRNA binding
ATP binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

ATP hydrolysis activity

isomerase activity [inference]

macromolecular conformation isomerase activity [inference]

nucleic acid conformation isomerase activity [inference]

helicase activity [inference]

RNA helicase activity

catalytic activity, acting on a nucleic acid [inference]

helicase activity [inference]

RNA helicase activity

catalytic activity, acting on RNA [inference]

RNA helicase activity

binding [inference]

nucleic acid binding [inference]

RNA binding

mRNA binding

protein binding [inference]

identical protein binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

ATP-dependent activity [inference]

helicase activity [inference]

RNA helicase activity

ATP-dependent activity, acting on RNA [inference]

RNA helicase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNVAELPEEIDISTYIEQSR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites