GlyCosmos Portal

Submissions

Cyclin-dependent kinase 2-associated protein 1

Summary

UniProt ID: O14519
Gene Symbol: CDK2AP1 CDKAP1 DOC1
Gene ID: 8099
Organism: Homo sapiens (human)

External Links

GlyGen: O14519
PubChem: O14519
The O-GlcNAc Database: O14519
O-GlcNAcAtlas: O14519
Re-Glyco: O14519

Annotation

Keyword: 3D-structure Alternative splicing Cell cycle Chromosome Disulfide bond Nucleus Phosphoprotein Proteomics identification Reference proteome Transcription regulation Tumor suppressor

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
positive regulation of protein phosphorylation
DNA-templated DNA replication	NAS	PMID
regulation of transcription by RNA polymerase II	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

nucleic acid metabolic process [inference]

DNA metabolic process [inference]

DNA replication [inference]

DNA-templated DNA replication

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

DNA metabolic process [inference]

DNA replication [inference]

DNA-templated DNA replication

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

regulation of phosphorus metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

regulation of phosphorylation [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

regulation of RNA metabolic process [inference]

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
chromatin	IDA	PMID
nucleus	IDA	PMID PMID PMID PMID
nucleus	IBA	GO_REF
nucleus	IEA	GO_REF
nucleoplasm	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome

GO Hierarchy

cellular component

protein-containing complex [inference]

transcription regulator complex [inference]

NuRD complex

nuclear protein-containing complex [inference]

histone deacetylase complex [inference]

NuRD complex

SWI/SNF superfamily-type complex [inference]

CHD-type complex [inference]

NuRD complex

catalytic complex [inference]

histone deacetylase complex [inference]

NuRD complex

ATPase complex [inference]

SWI/SNF superfamily-type complex [inference]

CHD-type complex [inference]

NuRD complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

perinuclear region of cytoplasm

Displaying 1 entry
GO Term	Evidence Code	Reference
DNA polymerase binding	IPI	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

DNA polymerase binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	PubMed ID	GlyTouCan ID	Source
21	35289036 39531497 39534244 40596516	G49108TO	The O-GlcNAc Database
26	35289036 39531497 39534244 40596516	G49108TO	The O-GlcNAc Database
27	35289036 39531497 39534244 40596516	G49108TO	The O-GlcNAc Database
28		G49108TO	GlyGen
31	35289036 39531497 39534244 40596516	G49108TO	GlyGen The O-GlcNAc Database
33	35289036 39531497 39534244 40596516	G49108TO	The O-GlcNAc Database