GlyCosmos Portal

Submissions

Angiopoietin-2

Summary

UniProt ID: O15123
Gene Symbol: ANGPT2
Gene ID: 285
Organism: Homo sapiens (human)

External Links

GlycoProtDB

GPDB0011185

GlyConnect

Angiopoietin-2

GlyGen

O15123

PubChem

O15123

Re-Glyco

O15123

Annotation

Keyword: 3D-structure Alternative splicing Angiogenesis Calcium Coiled coil Developmental protein Differentiation Disease variant Disulfide bond Glycoprotein Metal-binding Proteomics identification Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 24 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis	IDA	PMID PMID
angiogenesis	IBA	GO_REF
angiogenesis	IEA	GO_REF
response to hypoxia	IEA	GO_REF
signal transduction	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

Tie signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression

cellular process involved in reproduction in multicellular organism [inference]

germ cell development

cellular developmental process [inference]

cell development [inference]

germ cell development

reproductive process [inference]

developmental process involved in reproduction [inference]

germ cell development

multicellular organismal reproductive process [inference]

cellular process involved in reproduction in multicellular organism [inference]

germ cell development

maternal process involved in female pregnancy

multicellular organismal process [inference]

coagulation [inference]

blood coagulation

developmental process [inference]

developmental process involved in reproduction [inference]

germ cell development

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

anatomical structure development [inference]

blood vessel development [inference]

glomerulus vasculature development

regeneration [inference]

animal organ regeneration

cell development [inference]

germ cell development

animal organ development [inference]

animal organ regeneration

system development [inference]

vasculature development [inference]

renal system vasculature development [inference]

kidney vasculature development [inference]

glomerulus vasculature development

cellular developmental process [inference]

cell development [inference]

germ cell development

response to stimulus [inference]

response to stress [inference]

response to hypoxia

response to external stimulus [inference]

response to mechanical stimulus

response to abiotic stimulus [inference]

response to mechanical stimulus

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia

response to endogenous stimulus [inference]

response to growth factor [inference]

cellular response to growth factor stimulus

cellular response to endogenous stimulus [inference]

cellular response to growth factor stimulus

response to activity

response to chemical [inference]

response to oxygen-containing compound [inference]

response to carbohydrate [inference]

response to monosaccharide [inference]

response to hexose [inference]

response to glucose

biological regulation [inference]

regulation of biological process [inference]

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of chemotaxis [inference]

negative regulation of positive chemotaxis

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

regulation of chemotaxis [inference]

negative regulation of chemotaxis [inference]

negative regulation of positive chemotaxis

regulation of positive chemotaxis [inference]

negative regulation of positive chemotaxis

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

regulation of blood vessel endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

positive regulation of biological process [inference]

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of coagulation

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

negative regulation of biological process [inference]

negative regulation of locomotion [inference]

negative regulation of chemotaxis [inference]

negative regulation of positive chemotaxis

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-substrate adhesion

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of chemotaxis [inference]

negative regulation of positive chemotaxis

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of chemotaxis [inference]

negative regulation of positive chemotaxis

regulation of chemotaxis [inference]

negative regulation of chemotaxis [inference]

negative regulation of positive chemotaxis

regulation of positive chemotaxis [inference]

negative regulation of positive chemotaxis

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of chemotaxis [inference]

negative regulation of positive chemotaxis

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of cellular process [inference]

signal transduction

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

Tie signaling pathway

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-substrate adhesion

regulation of cell-substrate adhesion [inference]

negative regulation of cell-substrate adhesion

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-substrate adhesion

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

regulation of blood vessel endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

regulation of multicellular organismal process [inference]

regulation of coagulation [inference]

positive regulation of coagulation

positive regulation of multicellular organismal process [inference]

positive regulation of coagulation

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of biological quality [inference]

regulation of body fluid levels [inference]

hemostasis [inference]

blood coagulation

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	EXP	PMID
extracellular region	TAS	PMID Reactome
extracellular region	IDA	PMID PMID
extracellular region	IEA	GO_REF GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

cellular anatomical structure [inference]

Displaying **all 5** entries
GO Term	Evidence Code	Reference
signaling receptor binding	TAS	PMID PMID
receptor tyrosine kinase binding	IBA	GO_REF
receptor tyrosine kinase binding	IPI	PMID
metal ion binding
receptor ligand activity	IDA	PMID PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding

receptor tyrosine kinase binding

enzyme binding [inference]

kinase binding [inference]

protein kinase binding [inference]

protein tyrosine kinase binding [inference]

receptor tyrosine kinase binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
89	N-linked (GlcNAc...) asparagine	37074911	G98611JV G34989PA	GlycoProtDB UniProt GlyGen
119	N-linked (GlcNAc...) asparagine			GlycoProtDB UniProt GlyGen
133	N-linked (GlcNAc...) asparagine			GlycoProtDB UniProt GlyGen
151	N-linked (GlcNAc...) asparagine	37074911	G30221QT G81637OR G82443XX G05962QB G35541EV G93718GY G80479JV G62765YT	GlycoProtDB UniProt GlyGen
240	N-linked (GlcNAc...) asparagine	23345538 37074911	G45395BF G46691LC G27058EU G41071NU G70619PT G42124LM G90659AW G62765YT G10486CT G02815KT G32550BI	GlycoProtDB UniProt GlyGen GlyConnect
304	N-linked (GlcNAc...) asparagine	23345538	G20956ZV G74724QE	UniProt GlyGen GlyConnect