GlyCosmos Portal

Submissions

Solute carrier family 22 member 2

Summary

UniProt ID: O15244
Gene Symbol: OCT2 SLC22A2
Gene ID: 6582
Organism: Homo sapiens (human)

External Links

PubChem: O15244
The Human Metabolome Database: HMDBP04308
Re-Glyco: O15244

Annotation

Keyword: 3D-structure Alternative splicing Cell membrane Glycoprotein Ion transport Phosphoprotein Proteomics identification Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 38 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
monoatomic cation transport
neurotransmitter transport	TAS	Reactome Reactome
neurotransmitter transport	IDA	PMID
serotonin transport
body fluid secretion

GO Hierarchy

biological process

cellular process [inference]

transmembrane transport [inference]

amino acid transmembrane transport [inference]

amino acid import across plasma membrane

L-arginine import across plasma membrane

L-alpha-amino acid transmembrane transport

L-arginine import across plasma membrane

vitamin transmembrane transport [inference]

thiamine transmembrane transport

azole transmembrane transport [inference]

thiamine transmembrane transport

purine-containing compound transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport

import across plasma membrane [inference]

amino acid import across plasma membrane

L-arginine import across plasma membrane

export across plasma membrane

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport

L-arginine import across plasma membrane

export from cell [inference]

export across plasma membrane

cellular detoxification

multicellular organismal process [inference]

system process [inference]

circulatory system process [inference]

vascular process in circulatory system [inference]

vascular transport [inference]

transport across blood-brain barrier

xenobiotic transport across blood-brain barrier

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport

neurotransmitter transport

neurotransmitter uptake [inference]

histamine uptake

neurotransmitter reuptake [inference]

serotonin uptake

amino acid transport [inference]

amino acid transmembrane transport [inference]

amino acid import across plasma membrane

L-arginine import across plasma membrane

L-alpha-amino acid transmembrane transport

L-arginine import across plasma membrane

L-amino acid transport [inference]

L-alpha-amino acid transmembrane transport

L-arginine import across plasma membrane

lipid transport [inference]

fatty acid transport [inference]

prostaglandin transport

vascular transport [inference]

transport across blood-brain barrier

xenobiotic transport across blood-brain barrier

organic cation transport

norepinephrine transport

norepinephrine uptake

thiamine transport [inference]

thiamine transmembrane transport

organic anion transport [inference]

carboxylic acid transport [inference]

monocarboxylic acid transport [inference]

fatty acid transport [inference]

prostaglandin transport

L-amino acid transport [inference]

L-alpha-amino acid transmembrane transport

L-arginine import across plasma membrane

icosanoid transport [inference]

prostaglandin transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport

L-arginine import across plasma membrane

organic acid transport [inference]

carboxylic acid transport [inference]

monocarboxylic acid transport [inference]

fatty acid transport [inference]

prostaglandin transport

L-amino acid transport [inference]

L-alpha-amino acid transmembrane transport

L-arginine import across plasma membrane

icosanoid transport [inference]

prostaglandin transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport

L-arginine import across plasma membrane

organic hydroxy compound transport [inference]

serotonin transport

serotonin uptake

catecholamine transport [inference]

dopamine transport

dopamine uptake

norepinephrine transport

norepinephrine uptake

epinephrine transport

catecholamine uptake [inference]

xenobiotic transport

xenobiotic transport across blood-brain barrier

secretion [inference]

body fluid secretion

vitamin transport [inference]

thiamine transport [inference]

thiamine transmembrane transport

vitamin transmembrane transport [inference]

thiamine transmembrane transport

transmembrane transport [inference]

amino acid transmembrane transport [inference]

amino acid import across plasma membrane

L-arginine import across plasma membrane

L-alpha-amino acid transmembrane transport

L-arginine import across plasma membrane

vitamin transmembrane transport [inference]

thiamine transmembrane transport

azole transmembrane transport [inference]

thiamine transmembrane transport

purine-containing compound transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport

import across plasma membrane [inference]

amino acid import across plasma membrane

L-arginine import across plasma membrane

export across plasma membrane

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport

L-arginine import across plasma membrane

nitrogen compound transport [inference]

L-amino acid transport [inference]

L-alpha-amino acid transmembrane transport

L-arginine import across plasma membrane

amine transport

monoamine transport [inference]

serotonin transport

serotonin uptake

catecholamine transport [inference]

dopamine transport

dopamine uptake

norepinephrine transport

norepinephrine uptake

epinephrine transport

catecholamine uptake [inference]

polyamine transport [inference]

thiamine transport [inference]

thiamine transmembrane transport

azole transmembrane transport [inference]

thiamine transmembrane transport

histamine transport

histamine uptake

purine-containing compound transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport

sulfur compound transport [inference]

thiamine transport [inference]

thiamine transmembrane transport

import into cell [inference]

neurotransmitter uptake [inference]

histamine uptake

neurotransmitter reuptake [inference]

serotonin uptake

import across plasma membrane [inference]

amino acid import across plasma membrane

L-arginine import across plasma membrane

export from cell [inference]

export across plasma membrane

acetate ester transport [inference]

acetylcholine transport

establishment of localization in cell [inference]

neurotransmitter reuptake [inference]

serotonin uptake

biological regulation [inference]

regulation of biological quality [inference]

regulation of body fluid levels [inference]

body fluid secretion

detoxification [inference]

cellular detoxification

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	TAS	PMID Reactome Reactome Reactome Reactome Reactome
plasma membrane	IDA	PMID
basal plasma membrane	IDA	PMID
basal plasma membrane	IEA	GO_REF GO_REF
membrane	TAS	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

plasma membrane

plasma membrane region [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

presynapse

Displaying entries **1 - 5** of 25 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
amine transmembrane transporter activity	IDA	PMID
acetylcholine transmembrane transporter activity	IDA	PMID
neurotransmitter transmembrane transporter activity	TAS	Reactome Reactome
neurotransmitter transmembrane transporter activity	IDA	PMID PMID
monoamine transmembrane transporter activity	IDA	PMID PMID PMID PMID PMID PMID

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

amine transmembrane transporter activity

neurotransmitter transmembrane transporter activity

acetylcholine transmembrane transporter activity

amino acid transmembrane transporter activity [inference]

basic amino acid transmembrane transporter activity [inference]

L-arginine transmembrane transporter activity

L-amino acid transmembrane transporter activity

L-arginine transmembrane transporter activity

polyamine transmembrane transporter activity [inference]

nucleobase-containing compound transmembrane transporter activity [inference]

nucleoside transmembrane transporter activity [inference]

pyrimidine nucleoside transmembrane transporter activity

toxin transmembrane transporter activity

active transmembrane transporter activity [inference]

monoamine transmembrane transporter activity

xenobiotic transmembrane transporter activity

carboxylic acid transmembrane transporter activity [inference]

L-amino acid transmembrane transporter activity

L-arginine transmembrane transporter activity

vitamin transmembrane transporter activity [inference]

thiamine transmembrane transporter activity

lipid transmembrane transporter activity [inference]

icosanoid transmembrane transporter activity [inference]

prostaglandin transmembrane transporter activity

acetate ester transmembrane transporter activity [inference]

acetylcholine transmembrane transporter activity

azole transmembrane transporter activity [inference]

thiamine transmembrane transporter activity

carbohydrate derivative transmembrane transporter activity [inference]

nucleoside transmembrane transporter activity [inference]

pyrimidine nucleoside transmembrane transporter activity

sulfur compound transmembrane transporter activity [inference]

thiamine transmembrane transporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELSLRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLGPCRDGWVYETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIFYQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSVLYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLASVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGIITPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
72	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Abacavir transmembrane transport	Homo sapiens
Neurotransmitter clearance	Homo sapiens
Norepinephrine Neurotransmitter Release Cycle	Homo sapiens
Organic cation transport	Homo sapiens
SLC-mediated transport of neurotransmitters	Homo sapiens