GlyCosmos Portal

Submissions

Eukaryotic translation elongation factor 1 epsilon-1

Summary

UniProt ID: O43324
Gene Symbol: AIMP3 EEF1E1 P18
Gene ID: 9521
Organism: Homo sapiens (human)

External Links

GlyGen: O43324
PubChem: O43324
The O-GlcNAc Database: O43324
RaftProt: O43324
O-GlcNAcAtlas: O43324
Re-Glyco: O43324

Annotation

Keyword: 3D-structure Acetylation Alternative splicing Coiled coil Cytoplasm Direct protein sequencing Nucleus Protein biosynthesis Proteomics identification Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
translation
negative regulation of cell population proliferation	ISS	GO_REF
negative regulation of cell population proliferation	IEA	GO_REF
positive regulation of apoptotic process	ISS	GO_REF
positive regulation of apoptotic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

translation

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

translation

protein metabolic process [inference]

translation

primary metabolic process [inference]

protein metabolic process [inference]

translation

response to stimulus [inference]

response to chemical [inference]

response to peptide [inference]

response to cytokine [inference]

cellular response to cytokine stimulus [inference]

cellular response to leukemia inhibitory factor

response to leukemia inhibitory factor [inference]

cellular response to leukemia inhibitory factor

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of signal transduction by p53 class mediator [inference]

regulation of DNA damage response, signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of apoptotic signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway

positive regulation of cellular senescence

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of apoptotic signaling pathway

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of signal transduction by p53 class mediator [inference]

regulation of DNA damage response, signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of apoptotic signaling pathway

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of DNA damage response, signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of signal transduction by p53 class mediator [inference]

regulation of DNA damage response, signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of apoptotic signaling pathway

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

positive regulation of apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway

positive regulation of cellular senescence

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

regulation of cellular response to stress [inference]

regulation of DNA damage response, signal transduction by p53 class mediator [inference]

positive regulation of DNA damage response, signal transduction by p53 class mediator

regulation of cellular senescence [inference]

positive regulation of cellular senescence

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISS	GO_REF
nucleus	IBA	GO_REF
nucleus	IEA	GO_REF GO_REF GO_REF
nucleoplasm	IDA	GO_REF
nucleolus

GO Hierarchy

cellular component

protein-containing complex [inference]

intracellular protein-containing complex [inference]

aminoacyl-tRNA synthetase multienzyme complex

catalytic complex [inference]

aminoacyl-tRNA synthetase multienzyme complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nucleolus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

nucleolus

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
8		33214551 33465208 34019948 35254053 38665916 40596516	G49108TO	GlyGen The O-GlcNAc Database
132		33214551 33465208 34019948 35254053 38665916 40596516	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Cytosolic tRNA aminoacylation	Homo sapiens
Selenoamino acid metabolism	Homo sapiens
Transcriptional and post-translational regulation of MITF-M expression and activity	Homo sapiens