GlyCosmos Portal

Submissions

Prostate stem cell antigen

Summary

UniProt ID: O43653
Gene Symbol: PSCA UNQ206/PRO232
Gene ID: 8000
Organism: Homo sapiens (human)

External Links

GlyGen: O43653
RaftProt: O43653
Re-Glyco: O43653

Annotation

Keyword: Cell membrane Direct protein sequencing Disulfide bond GPI-anchor Proteomics identification Reference proteome Signal

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
negative regulation of ERK1 and ERK2 cascade	IDA	PMID
acetylcholine receptor signaling pathway	IBA	GO_REF
regulation of neurotransmitter receptor activity	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

postsynaptic signal transduction [inference]

acetylcholine receptor signaling pathway

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of signaling receptor activity [inference]

regulation of neurotransmitter receptor activity

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of signaling receptor activity [inference]

regulation of neurotransmitter receptor activity

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of cellular process [inference]

signal transduction [inference]

postsynaptic signal transduction [inference]

acetylcholine receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of signaling receptor activity [inference]

regulation of neurotransmitter receptor activity

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of molecular function [inference]

regulation of signaling receptor activity [inference]

regulation of neurotransmitter receptor activity

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	TAS	Reactome
plasma membrane	TAS	PMID Reactome
plasma membrane	IDA	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

membrane [inference]

plasma membrane

cell junction [inference]

synapse

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

side of membrane

Displaying **all 3** entries
GO Term	Evidence Code	Reference
acetylcholine receptor regulator activity	IBA	GO_REF
acetylcholine receptor binding	IDA	PMID
acetylcholine receptor binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

acetylcholine receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

neurotransmitter receptor regulator activity [inference]

acetylcholine receptor regulator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
31	N-linked (GlcNAc...) asparagine			UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Post-translational modification: synthesis of GPI-anchored proteins	Homo sapiens

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements