GlyCosmos Portal

Submissions

Speckle-type POZ protein

Summary

UniProt ID

O43791

Gene Symbol

SPOP

Gene ID

[8405]

Organism

Homo sapiens (human)

External Links

PubChem: O43791
The O-GlcNAc Database: O43791
RaftProt: O43791
Re-Glyco: O43791

Annotation

Keyword: 3D-structure Cytoplasm Host-virus interaction Intellectual disability Nucleus Proteomics identification Reference proteome Ubl conjugation pathway

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
protein polyubiquitination	IDA	PMID
regulation of proteolysis	IBA	GO_REF
proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	PMID
proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	PMID PMID
proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination [inference]

protein polyubiquitination

macromolecule modification [inference]

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination [inference]

protein polyubiquitination

primary metabolic process [inference]

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination [inference]

protein polyubiquitination

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of macromolecule metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of proteolysis

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of proteolysis

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	EXP	PMID PMID
nucleus	TAS	PMID
nucleus	IDA	PMID
nucleus	IBA	GO_REF
nucleus	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

intracellular protein-containing complex [inference]

ubiquitin ligase complex [inference]

cullin-RING ubiquitin ligase complex [inference]

Cul3-RING ubiquitin ligase complex

catalytic complex [inference]

transferase complex [inference]

ubiquitin ligase complex [inference]

cullin-RING ubiquitin ligase complex [inference]

Cul3-RING ubiquitin ligase complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

supramolecular complex [inference]

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

Displaying **all 4** entries
GO Term	Evidence Code	Reference
ubiquitin protein ligase binding	IBA	GO_REF
ubiquitin protein ligase binding	IPI	PMID
identical protein binding	IPI	PMID PMID
molecular function inhibitor activity	EXP	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

ubiquitin-like protein ligase binding [inference]

ubiquitin protein ligase binding

identical protein binding

molecular function regulator activity [inference]

molecular function inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
96		36604567 40596516	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Hedgehog 'on' state	Homo sapiens
SPOP-mediated proteasomal degradation of PD-L1(CD274)	Homo sapiens

Disease

Displaying **all 3** entries
DO ID	Disease Name	Source
DOID:9256	colorectal cancer	Alliance of Genome Resources
DOID:3910	lung adenocarcinoma	Alliance of Genome Resources
DOID:684	hepatocellular carcinoma	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements