GlyCosmos Portal

Submissions

Cathepsin L-like

Summary

UniProt ID: O45734
Gene Symbol: cpl-1 T03E6.7
Gene ID: 180111
Organism: Caenorhabditis elegans

External Links

GlycoProtDB: GPDB0000459
Re-Glyco: O45734

Annotation

Keyword: Alternative splicing Cytoplasmic vesicle Disulfide bond Endosome Glycoprotein Lysosome Reference proteome Secreted Signal Thiol protease Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
immune response	IBA	GO_REF
apoptotic cell clearance	IMP	PMID
obsolete proteolysis involved in protein catabolic process
regulation of apoptosis involved in tissue homeostasis	IMP	PMID
regulation of protein processing	IMP	PMID PMID

GO Hierarchy

biological process

immune system process [inference]

immune response

cellular process [inference]

vesicle-mediated transport [inference]

endocytosis [inference]

phagocytosis [inference]

apoptotic cell clearance

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

lipid droplet organization [inference]

lipid droplet disassembly

organelle disassembly [inference]

lipid droplet disassembly

cellular component disassembly [inference]

organelle disassembly [inference]

lipid droplet disassembly

response to stimulus [inference]

immune response

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

endocytosis [inference]

phagocytosis [inference]

apoptotic cell clearance

import into cell [inference]

endocytosis [inference]

phagocytosis [inference]

apoptotic cell clearance

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway

positive regulation of cellular component organization [inference]

positive regulation of vitellogenesis

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

positive regulation of multicellular organismal process [inference]

positive regulation of vitellogenesis

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of protein maturation [inference]

regulation of protein processing

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of protein maturation [inference]

regulation of protein processing

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

regulation of protein processing

regulation of protein maturation [inference]

regulation of protein processing

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

regulation of protein processing

regulation of protein maturation [inference]

regulation of protein processing

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway

regulation of apoptosis involved in tissue homeostasis

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway

positive regulation of cellular component organization [inference]

positive regulation of vitellogenesis

regulation of cellular component organization [inference]

positive regulation of cellular component organization [inference]

positive regulation of vitellogenesis

regulation of vitellogenesis [inference]

positive regulation of vitellogenesis

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of vitellogenesis

regulation of vitellogenesis [inference]

positive regulation of vitellogenesis

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
cytoplasm	IDA	PMID
lysosome	EXP	PMID PMID
lysosome	IBA	GO_REF
lysosome	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

membrane-enclosed lumen [inference]

organelle lumen [inference]

vesicle lumen

yolk granule

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

endolysosome

endocytic vesicle [inference]

phagocytic vesicle [inference]

phagolysosome

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

secondary lysosome [inference]

phagolysosome

endolysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

endolysosome

endocytic vesicle [inference]

phagocytic vesicle [inference]

phagolysosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

secondary lysosome [inference]

phagolysosome

endolysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

endolysosome

endocytic vesicle [inference]

phagocytic vesicle [inference]

phagolysosome

Displaying **all 3** entries
GO Term	Evidence Code	Reference
cysteine-type endopeptidase activity	ISS	GO_REF
cysteine-type endopeptidase activity	IEA	GO_REF
cysteine-type endopeptidase activator activity involved in apoptotic process	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity [inference]

cysteine-type endopeptidase activity

cysteine-type peptidase activity [inference]

cysteine-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity [inference]

cysteine-type endopeptidase activity

cysteine-type peptidase activity [inference]

cysteine-type endopeptidase activity

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

peptidase activator activity [inference]

peptidase activator activity involved in apoptotic process [inference]

cysteine-type endopeptidase activator activity involved in apoptotic process

cysteine-type endopeptidase regulator activity involved in apoptotic process [inference]

cysteine-type endopeptidase activator activity involved in apoptotic process

peptidase regulator activity [inference]

peptidase activator activity [inference]

peptidase activator activity involved in apoptotic process [inference]

cysteine-type endopeptidase activator activity involved in apoptotic process

molecular function activator activity [inference]

enzyme activator activity [inference]

peptidase activator activity [inference]

peptidase activator activity involved in apoptotic process [inference]

cysteine-type endopeptidase activator activity involved in apoptotic process

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNRFILLALVAAVVAVNSAKLSRQIESAIEKWDDYKEDFDKEYSESEEQTYMEAFVKNMIHIENHNRDHRLGRKTFEMGLNHIADLPFSQYRKLNGYRRLFGDSRIKNSSSFLAPFNVQVPDEVDWRDTHLVTDVKNQGMCGSCWAFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDTEESYPYKGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHGDYWIVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites