GlyCosmos Portal

Submissions

Beta-1,4-galactosyltransferase 4

Summary

UniProt ID: O60513
Gene Symbol: B4GALT4 UNQ552/PRO1109 hCG_22565
Gene ID: 8702
Organism: Homo sapiens (human)

External Links

GlycoProtDB

GPDB0011228

GlyGen

O60513

PubChem

O60513

SwissLipids

SLP:000000791

The Human Metabolome Database

HMDBP01033

Re-Glyco

O60513

Annotation

Keyword: Disulfide bond Glycoprotein Glycosyltransferase Golgi apparatus Lipid metabolism Manganese Metal-binding Proteomics identification Reference proteome Secreted Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
lactosylceramide biosynthetic process	IDA	PMID
carbohydrate metabolic process	IEA	GO_REF
obsolete membrane lipid metabolic process
keratan sulfate proteoglycan biosynthetic process	IDA	PMID
keratan sulfate proteoglycan biosynthetic process	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

lipid biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

lactosylceramide biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

lactosylceramide biosynthetic process

ceramide biosynthetic process [inference]

lactosylceramide biosynthetic process

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

proteoglycan biosynthetic process [inference]

keratan sulfate proteoglycan biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

proteoglycan biosynthetic process [inference]

keratan sulfate proteoglycan biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

lactosylceramide biosynthetic process

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

proteoglycan biosynthetic process [inference]

keratan sulfate proteoglycan biosynthetic process

protein metabolic process [inference]

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan biosynthetic process [inference]

keratan sulfate proteoglycan biosynthetic process

keratan sulfate proteoglycan metabolic process [inference]

keratan sulfate proteoglycan biosynthetic process

glycoprotein biosynthetic process [inference]

proteoglycan biosynthetic process [inference]

keratan sulfate proteoglycan biosynthetic process

primary metabolic process [inference]

carbohydrate metabolic process

lipid metabolic process [inference]

sphingolipid metabolic process [inference]

ceramide metabolic process [inference]

ceramide biosynthetic process [inference]

lactosylceramide biosynthetic process

glycosphingolipid metabolic process [inference]

glycosphingolipid biosynthetic process [inference]

lactosylceramide biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

lactosylceramide biosynthetic process

ceramide biosynthetic process [inference]

lactosylceramide biosynthetic process

lipid biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

lactosylceramide biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

lactosylceramide biosynthetic process

ceramide biosynthetic process [inference]

lactosylceramide biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

glycosphingolipid biosynthetic process [inference]

lactosylceramide biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

lactosylceramide biosynthetic process

protein metabolic process [inference]

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan biosynthetic process [inference]

keratan sulfate proteoglycan biosynthetic process

keratan sulfate proteoglycan metabolic process [inference]

keratan sulfate proteoglycan biosynthetic process

glycoprotein biosynthetic process [inference]

proteoglycan biosynthetic process [inference]

keratan sulfate proteoglycan biosynthetic process

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan biosynthetic process [inference]

keratan sulfate proteoglycan biosynthetic process

keratan sulfate proteoglycan metabolic process [inference]

keratan sulfate proteoglycan biosynthetic process

glycoprotein biosynthetic process [inference]

proteoglycan biosynthetic process [inference]

keratan sulfate proteoglycan biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

proteoglycan biosynthetic process [inference]

keratan sulfate proteoglycan biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

lactosylceramide biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

glycosphingolipid biosynthetic process [inference]

lactosylceramide biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

lactosylceramide biosynthetic process

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	TAS	Reactome Reactome Reactome Reactome
Golgi membrane	IDA	PMID
Golgi membrane	IEA	GO_REF GO_REF
extracellular region	EXP	PMID
extracellular region	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

membrane

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity	IDA	PMID
beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity	IEA	GO_REF
N-acetyllactosamine synthase activity	IDA	PMID
N-acetyllactosamine synthase activity	IEA	GO_REF GO_REF
galactosyltransferase activity	TAS	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

UDP-glycosyltransferase activity [inference]

UDP-galactosyltransferase activity

hexosyltransferase activity [inference]

galactosyltransferase activity

UDP-galactosyltransferase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
62		23584533	G57321FI	GlyGen
69		30459171	G43417UB	GlyGen
220	N-linked (GlcNAc...) asparagine	32827291		GlycoProtDB UniProt GlyGen
335	N-linked (GlcNAc...) asparagine	32827291		UniProt GlyGen