GlyCosmos Portal

Submissions

Protein-tyrosine sulfotransferase 2

Summary

UniProt ID: O60704
Gene Symbol: TPST2
Gene ID: 8459
Organism: Homo sapiens (human)

External Links

GlyGen: O60704
PubChem: O60704
The Human Metabolome Database: HMDBP00354
RaftProt: O60704
Re-Glyco: O60704

Annotation

Keyword: 3D-structure Disulfide bond Glycoprotein Golgi apparatus Proteomics identification Reference proteome Signal-anchor Transferase Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
peptidyl-tyrosine sulfation	TAS	Reactome
peptidyl-tyrosine sulfation	IDA	PMID PMID
fusion of sperm to egg plasma membrane involved in single fertilization
3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	Reactome
3'-phosphoadenosine 5'-phosphosulfate metabolic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

sulfur compound metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

sulfation [inference]

protein sulfation [inference]

peptidyl-tyrosine sulfation

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

nucleoside bisphosphate metabolic process [inference]

ribonucleoside bisphosphate metabolic process [inference]

purine ribonucleoside bisphosphate metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

purine nucleoside bisphosphate metabolic process [inference]

purine ribonucleoside bisphosphate metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

nucleoside bisphosphate metabolic process [inference]

ribonucleoside bisphosphate metabolic process [inference]

purine ribonucleoside bisphosphate metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

purine nucleoside bisphosphate metabolic process [inference]

purine ribonucleoside bisphosphate metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

macromolecule metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

protein sulfation [inference]

peptidyl-tyrosine sulfation

peptidyl-amino acid modification [inference]

peptidyl-tyrosine modification [inference]

peptidyl-tyrosine sulfation

macromolecule modification [inference]

protein modification process [inference]

protein sulfation [inference]

peptidyl-tyrosine sulfation

peptidyl-amino acid modification [inference]

peptidyl-tyrosine modification [inference]

peptidyl-tyrosine sulfation

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

nucleoside bisphosphate metabolic process [inference]

ribonucleoside bisphosphate metabolic process [inference]

purine ribonucleoside bisphosphate metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

purine nucleoside bisphosphate metabolic process [inference]

purine ribonucleoside bisphosphate metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

protein metabolic process [inference]

protein modification process [inference]

protein sulfation [inference]

peptidyl-tyrosine sulfation

peptidyl-amino acid modification [inference]

peptidyl-tyrosine modification [inference]

peptidyl-tyrosine sulfation

small molecule metabolic process [inference]

organic acid metabolic process [inference]

oxoacid metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

nucleoside bisphosphate metabolic process [inference]

ribonucleoside bisphosphate metabolic process [inference]

purine ribonucleoside bisphosphate metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

purine nucleoside bisphosphate metabolic process [inference]

purine ribonucleoside bisphosphate metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

purine nucleoside bisphosphate metabolic process [inference]

purine ribonucleoside bisphosphate metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

3'-phosphoadenosine 5'-phosphosulfate metabolic process

cellular process involved in reproduction in multicellular organism [inference]

fusion of sperm to egg plasma membrane involved in single fertilization

reproductive process [inference]

multicellular organismal reproductive process [inference]

cellular process involved in reproduction in multicellular organism [inference]

fusion of sperm to egg plasma membrane involved in single fertilization

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of reproductive process [inference]

negative regulation of fertilization [inference]

prevention of polyspermy

regulation of reproductive process [inference]

regulation of fertilization [inference]

negative regulation of fertilization [inference]

prevention of polyspermy

negative regulation of reproductive process [inference]

negative regulation of fertilization [inference]

prevention of polyspermy

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	EXP	PMID
Golgi membrane	TAS	Reactome Reactome Reactome
Golgi membrane	IEA	GO_REF
endoplasmic reticulum	IDA	GO_REF
Golgi apparatus	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

Golgi lumen

organelle subcompartment [inference]

Golgi apparatus subcompartment [inference]

trans-Golgi network

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying **all 5** entries
GO Term	Evidence Code	Reference
protein-tyrosine sulfotransferase activity	TAS	Reactome Reactome Reactome
protein-tyrosine sulfotransferase activity	IDA	PMID PMID
protein-tyrosine sulfotransferase activity	IBA	GO_REF
protein-tyrosine sulfotransferase activity	IEA	GO_REF GO_REF GO_REF GO_REF GO_REF
protein homodimerization activity	IPI	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring sulphur-containing groups [inference]

sulfotransferase activity [inference]

protein-tyrosine sulfotransferase activity

catalytic activity, acting on a protein [inference]

protein-tyrosine sulfotransferase activity

binding [inference]

protein binding [inference]

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 10** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
58		24190977		GlyGen
261		23584533	G57321FI	GlyGen
271		23584533	G57321FI	GlyGen
278		23584533 25813380	G57321FI	GlyGen
280		23584533	G57321FI	GlyGen
285		23584533 25813380	G57321FI	GlyGen
286		23584533 25813380 30459171	G43417UB G57321FI	GlyGen
343	N-linked (GlcNAc...) asparagine			UniProt GlyGen
366		24190977		GlyGen
368	N-linked (GlcNAc...) asparagine	24190977	G80920RR	UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Cytosolic sulfonation of small molecules	Homo sapiens
Defective F8 sulfation at Y1699	Homo sapiens
Differentiation of naive CD4+ T cells to T helper 1 cells (Th1 cells)	Homo sapiens
Gamma carboxylation, hypusinylation, hydroxylation, and arylsulfatase activation	Homo sapiens