GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Cyclin-dependent kinase 2-associated protein 2

Summary

UniProt ID: O75956
Gene Symbol: CDK2AP2 DOC1R
Gene ID: 10263
Organism: Homo sapiens (human)

External Links

GlyGen: O75956
PubChem: O75956
The O-GlcNAc Database: O75956
Re-Glyco: O75956

Annotation

Keyword: 3D-structure Cytoplasm Nucleus Phosphoprotein Proteomics identification Reference proteome

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
regulation of microtubule cytoskeleton organization	ISS	GO_REF
regulation of microtubule cytoskeleton organization	IBA	GO_REF
regulation of stem cell division	ISS	GO_REF
negative regulation of G1/S transition of mitotic cell cycle	IMP	PMID
negative regulation of G1/S transition of mitotic cell cycle	IBA	GO_REF

GO Hierarchy

biological process

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell cycle [inference]

negative regulation of cell cycle process [inference]

negative regulation of cell cycle phase transition [inference]

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

negative regulation of cell cycle G1/S phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

negative regulation of mitotic cell cycle [inference]

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

regulation of cellular process [inference]

regulation of microtubule-based process [inference]

regulation of microtubule cytoskeleton organization

negative regulation of cellular process [inference]

negative regulation of cell cycle [inference]

negative regulation of cell cycle process [inference]

negative regulation of cell cycle phase transition [inference]

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

negative regulation of cell cycle G1/S phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

negative regulation of mitotic cell cycle [inference]

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

regulation of cytoskeleton organization [inference]

regulation of microtubule cytoskeleton organization

regulation of cell division [inference]

regulation of stem cell division

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

negative regulation of mitotic cell cycle [inference]

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

regulation of mitotic cell cycle phase transition [inference]

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

regulation of G1/S transition of mitotic cell cycle [inference]

negative regulation of G1/S transition of mitotic cell cycle

regulation of cell cycle process [inference]

negative regulation of cell cycle process [inference]

negative regulation of cell cycle phase transition [inference]

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

negative regulation of cell cycle G1/S phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

regulation of cell cycle phase transition [inference]

negative regulation of cell cycle phase transition [inference]

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

negative regulation of cell cycle G1/S phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

regulation of mitotic cell cycle phase transition [inference]

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

regulation of G1/S transition of mitotic cell cycle [inference]

negative regulation of G1/S transition of mitotic cell cycle

regulation of cell cycle G1/S phase transition [inference]

negative regulation of cell cycle G1/S phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

regulation of G1/S transition of mitotic cell cycle [inference]

negative regulation of G1/S transition of mitotic cell cycle

negative regulation of cell cycle [inference]

negative regulation of cell cycle process [inference]

negative regulation of cell cycle phase transition [inference]

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

negative regulation of cell cycle G1/S phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

negative regulation of mitotic cell cycle [inference]

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G1/S transition of mitotic cell cycle

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISS	GO_REF
nucleus	EXP	PMID
nucleus	IDA	PMID
nucleus	IBA	GO_REF
nucleus	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

transcription regulator complex [inference]

NuRD complex

nuclear protein-containing complex [inference]

histone deacetylase complex [inference]

NuRD complex

SWI/SNF superfamily-type complex [inference]

CHD-type complex [inference]

NuRD complex

catalytic complex [inference]

histone deacetylase complex [inference]

NuRD complex

ATPase complex [inference]

SWI/SNF superfamily-type complex [inference]

CHD-type complex [inference]

NuRD complex

cellular anatomical structure [inference]

cytoplasm

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

supramolecular complex [inference]

supramolecular polymer [inference]

supramolecular fiber [inference]

polymeric cytoskeletal fiber [inference]

microtubule

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
13				GlyGen
18				GlyGen
79		38253038	G49108TO	The O-GlcNAc Database
95		38253038	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Interaction of NuRD complexes with transcription factors	Homo sapiens
NuRD complex assembly	Homo sapiens

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026