GlyCosmos Portal

Submissions

Cytochrome P450 1A2

Summary

UniProt ID: P00186
Gene Symbol: Cyp1a-2 Cyp1a2
Gene ID: 13077
Organism: Mus musculus (house mouse)

External Links

PubChem: P00186
Re-Glyco: P00186

Annotation

Keyword: Direct protein sequencing Fatty acid metabolism Glycoprotein Heme Lyase Membrane Microsome Monooxygenase Reference proteome Sterol metabolism

Gene Ontology (GO)

Displaying entries **1 - 5** of 38 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
steroid catabolic process	ISO	GO_REF
steroid catabolic process	IBA	GO_REF
steroid catabolic process	IEA	GO_REF
porphyrin-containing compound metabolic process	IMP	PMID PMID
xenobiotic metabolic process	ISO	GO_REF GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

generation of precursor metabolites and energy [inference]

energy derivation by oxidation of organic compounds [inference]

cellular respiration

xenobiotic metabolic process

xenobiotic catabolic process

catabolic process [inference]

lipid catabolic process [inference]

steroid catabolic process

xenobiotic catabolic process

biosynthetic process [inference]

secondary metabolite biosynthetic process [inference]

toxin biosynthetic process

reactive oxygen species biosynthetic process [inference]

hydrogen peroxide biosynthetic process

alkaloid metabolic process

secondary metabolic process [inference]

toxin metabolic process

toxin biosynthetic process

secondary metabolite biosynthetic process [inference]

toxin biosynthetic process

tetrapyrrole metabolic process [inference]

porphyrin-containing compound metabolic process

hormone metabolic process [inference]

primary metabolic process [inference]

lipid metabolic process [inference]

fatty acid metabolic process [inference]

long-chain fatty acid metabolic process [inference]

arachidonate metabolic process

unsaturated fatty acid metabolic process [inference]

arachidonate metabolic process

isoprenoid metabolic process [inference]

terpenoid metabolic process [inference]

monoterpenoid metabolic process

diterpenoid metabolic process [inference]

retinoid metabolic process [inference]

retinol metabolic process

steroid metabolic process [inference]

sterol metabolic process [inference]

cholesterol metabolic process

lipid catabolic process [inference]

steroid catabolic process

small molecule metabolic process [inference]

alcohol metabolic process [inference]

primary alcohol metabolic process [inference]

retinol metabolic process

secondary alcohol metabolic process [inference]

cholesterol metabolic process

organic acid metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

icosanoid metabolic process [inference]

arachidonate metabolic process

monocarboxylic acid metabolic process

fatty acid metabolic process [inference]

long-chain fatty acid metabolic process [inference]

arachidonate metabolic process

unsaturated fatty acid metabolic process [inference]

arachidonate metabolic process

dibenzo-p-dioxin metabolic process

demethylation [inference]

oxidative demethylation

reactive oxygen species metabolic process [inference]

hydrogen peroxide metabolic process [inference]

hydrogen peroxide biosynthetic process

reactive oxygen species biosynthetic process [inference]

hydrogen peroxide biosynthetic process

olefinic compound metabolic process [inference]

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to metal ion [inference]

cellular response to cadmium ion

multicellular organismal process [inference]

post-embryonic development

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

lung development

response to stimulus [inference]

response to chemical [inference]

response to metal ion [inference]

response to cadmium ion [inference]

cellular response to cadmium ion

cellular response to metal ion [inference]

cellular response to cadmium ion

cellular response to chemical stimulus [inference]

cellular response to metal ion [inference]

cellular response to cadmium ion

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to metal ion [inference]

cellular response to cadmium ion

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

Displaying **all 3** entries
GO Term	Evidence Code	Reference
mitochondrion	IBA	GO_REF
endoplasmic reticulum membrane	ISS	GO_REF
endoplasmic reticulum membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

Displaying entries **1 - 5** of 28 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
monooxygenase activity	ISO	GO_REF GO_REF
monooxygenase activity	IEA	GO_REF GO_REF
iron ion binding	IEA	GO_REF
steroid hydroxylase activity	IBA	GO_REF
oxidoreductase activity	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity

monooxygenase activity

steroid hydroxylase activity

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen

oxidoreductase activity, acting on other nitrogenous compounds as donors [inference]

oxidoreductase activity, acting on other nitrogenous compounds as donors, cytochrome as acceptor [inference]

nitrite reductase (NO-forming) activity

nitrite reductase activity [inference]

nitrite reductase (NO-forming) activity

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [inference]

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen

oxidoreductase activity, acting on CH or CH2 groups [inference]

oxidoreductase activity, acting on CH or CH2 groups, quinone or similar compound as acceptor [inference]

caffeine oxidase activity

lyase activity [inference]

carbon-oxygen lyase activity [inference]

hydro-lyase activity [inference]

hydroperoxy icosatetraenoate dehydratase activity

demethylase activity

binding [inference]

protein binding [inference]

enzyme binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

iron ion binding

tetrapyrrole binding [inference]

heme binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAFSQYISLAPELLLATAIFCLVFWMVRASRTQVPKGLKNPPGPWGLPFIGHMLTVGKNPHLSLTRLSQQYGDVLQIRIGSTPVVVLSGLNTIKQALVRQGDDFKGRPDLYSFTLITNGKSMTFNPDSGPVWAARRRLAQDALKSFSIASDPTSASSCYLEEHVSKEANHLVSKLQKAMAEVGHFEPVSQVVESVANVIGAMCFGKNFPRKSEEMLNIVNNSKDFVENVTSGNAVDFFPVLRYLPNPALKRFKTFNDNFVLFLQKTVQEHYQDFNKNSIQDITSALFKHSENYKDNGGLIPEEKIVNIVNDIFGAGFDTVTTAITWSILLLVTWPNVQRKIHEELDTVVGRDRQPRLSDRPQLPYLEAFILEIYRYTSFVPFTIPHSTTRDTSLNGFHIPKERCIYINQWQVNHDEKQWKDPFVFRPERFLTNNNSAIDKTQSEKVMLFGLGKRRCIGEIPAKWEVFLFLAILLQHLEFSVPPGVKVDLTPNYGLTMKPGTCEHVQAWPRFSK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
68	O-linked (GlcNAc) serine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 7** entries
Pathway Name	Organism
Aflatoxin activation and detoxification	Mus musculus
Aromatic amines can be N-hydroxylated or N-dealkylated by CYP1A2	Mus musculus
Biosynthesis of maresin-like SPMs	Mus musculus
Biosynthesis of protectins	Mus musculus
Methylation	Mus musculus
Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE)	Mus musculus
Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET)	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements