GlyCosmos Portal

Submissions

Thy-1 membrane glycoprotein

Summary

UniProt ID: P01831
Gene Symbol: Thy1 Thy-1
Gene ID: 21838
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB

GPDB0003254

GlyConnect

Thy-1 membrane glycoprotein

GlyGen

P01831

The O-GlcNAc Database

P01831

RaftProt

P01831

Re-Glyco

P01831

Annotation

Keyword: Cell membrane Direct protein sequencing Disulfide bond GPI-anchor Immunoglobulin domain Pyrrolidone carboxylic acid Reference proteome Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 44 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis	IDA	PMID
regulation of cell-matrix adhesion	ISO	GO_REF
regulation of cell-matrix adhesion	IEA	GO_REF
positive regulation of cellular extravasation	ISO	GO_REF
positive regulation of cellular extravasation	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

cellular process [inference]

cell communication [inference]

cell-cell signaling

cell adhesion [inference]

cell-cell adhesion

heterotypic cell-cell adhesion

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

integrin-mediated signaling pathway

cellular developmental process [inference]

cell development [inference]

neuron development [inference]

photoreceptor cell development [inference]

eye photoreceptor cell development [inference]

retinal cone cell development

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

receptor clustering

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization

cellular component assembly [inference]

cell junction assembly [inference]

cell-substrate junction assembly [inference]

focal adhesion assembly

cell junction organization [inference]

cell junction assembly [inference]

cell-substrate junction assembly [inference]

focal adhesion assembly

cell-substrate junction organization [inference]

cell-substrate junction assembly [inference]

focal adhesion assembly

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

anatomical structure development [inference]

cell development [inference]

neuron development [inference]

photoreceptor cell development [inference]

eye photoreceptor cell development [inference]

retinal cone cell development

cellular developmental process [inference]

cell development [inference]

neuron development [inference]

photoreceptor cell development [inference]

eye photoreceptor cell development [inference]

retinal cone cell development

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein localization to membrane [inference]

receptor clustering

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

receptor clustering

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of cellular extravasation [inference]

positive regulation of cellular extravasation

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of T cell activation [inference]

positive regulation of T cell activation

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

signaling [inference]

cell-cell signaling

regulation of localization [inference]

regulation of transport [inference]

regulation of transmembrane transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of calcium ion transport [inference]

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of monoatomic ion transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of monoatomic ion transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of cellular extravasation [inference]

positive regulation of cellular extravasation

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of cellular process [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of cellular component biogenesis [inference]

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of cellular component organization [inference]

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of monoatomic ion transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of neuron projection regeneration

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of neuron projection regeneration

negative regulation of multicellular organismal process [inference]

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of neuron projection regeneration

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of neuron projection regeneration [inference]

negative regulation of neuron projection regeneration

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of axonogenesis [inference]

negative regulation of axonogenesis

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of neurogenesis [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of neuron projection regeneration

regulation of neuron projection regeneration [inference]

negative regulation of neuron projection regeneration

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

integrin-mediated signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of phosphorylation [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of kinase activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

regulation of cell adhesion [inference]

regulation of cell-substrate adhesion [inference]

regulation of cell-matrix adhesion

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

regulation of transmembrane transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

regulation of cellular component biogenesis [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

regulation of cell junction assembly [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of neurogenesis [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

positive regulation of cellular process [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of cellular component biogenesis [inference]

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of cellular component organization [inference]

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of antigen receptor-mediated signaling pathway [inference]

negative regulation of T cell receptor signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of T cell activation [inference]

positive regulation of T cell activation

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development [inference]

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

negative regulation of neuron projection development [inference]

regulation of axonogenesis [inference]

negative regulation of axonogenesis

regulation of neuron projection regeneration [inference]

negative regulation of neuron projection regeneration

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development [inference]

positive regulation of cellular component organization [inference]

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

regulation of cell-substrate junction organization [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

regulation of cell junction assembly [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

regulation of cellular response to stress [inference]

regulation of neuron projection regeneration [inference]

negative regulation of neuron projection regeneration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of cellular extravasation [inference]

positive regulation of cellular extravasation

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of T cell activation [inference]

positive regulation of T cell activation

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

negative regulation of multicellular organismal process [inference]

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of axonogenesis

regulation of molecular function [inference]

negative regulation of molecular function [inference]

negative regulation of catalytic activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of molecular function [inference]

positive regulation of catalytic activity [inference]

positive regulation of hydrolase activity [inference]

positive regulation of GTPase activity

regulation of catalytic activity [inference]

positive regulation of catalytic activity [inference]

positive regulation of hydrolase activity [inference]

positive regulation of GTPase activity

negative regulation of catalytic activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of hydrolase activity [inference]

regulation of GTPase activity [inference]

positive regulation of GTPase activity

positive regulation of hydrolase activity [inference]

positive regulation of GTPase activity

regulation of transferase activity [inference]

regulation of kinase activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

Displaying entries **1 - 5** of 34 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
endoplasmic reticulum	ISO	GO_REF
endoplasmic reticulum	IEA	GO_REF
cytosol	ISO	GO_REF
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

plasma membrane region [inference]

apical plasma membrane

cell projection membrane [inference]

neuron projection membrane [inference]

membrane microdomain [inference]

membrane raft

cell junction [inference]

synapse [inference]

glutamatergic synapse

site of polarized growth [inference]

growth cone

leading edge membrane [inference]

neuron projection membrane [inference]

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

dendrite

myelin sheath

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

cell body membrane [inference]

neuronal cell body membrane

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
GTPase activator activity	ISS	GO_REF
GTPase activator activity	ISO	GO_REF
GTPase activator activity	IBA	GO_REF
integrin binding	ISO	GO_REF
integrin binding	IMP	PMID PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

integrin binding

enzyme binding

kinase binding [inference]

protein kinase binding

cell adhesion molecule binding [inference]

integrin binding

lipid binding [inference]

phospholipid binding [inference]

GPI anchor binding

glycolipid binding [inference]

GPI anchor binding

protein-containing complex binding [inference]

integrin binding

carbohydrate derivative binding [inference]

glycolipid binding [inference]

GPI anchor binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

GTPase activator activity

nucleoside-triphosphatase regulator activity [inference]

GTPase regulator activity [inference]

GTPase activator activity

molecular function activator activity [inference]

enzyme activator activity [inference]

GTPase activator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNPAISVALLLSVLQVSRGQKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKCGGISLLVQNTSWMLLLLLSLSLLQALDFISL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
42	N-linked (GlcNAc...) asparagine	30899004 6177036	G54612UD G25418HZ G10773YW G70418MS G24835MQ G76613WN G85228QD G44215PV G06356OH G23294PN G70101JE G70961NC G82053YT G65092SV G74430RZ G31916IQ G84820NF G64527OM G46687AB G72735IY G05724UK G93180LE G49874UX G33609NS G29880MM G39188ZX G25637MV G94854LT G02815KT G06110VR G00406II G66538GV G14669DU G63628AV G32550BI G71838YU	GlycoProtDB UniProt GlyGen GlyConnect
44		26192747 33300544 40885482	G49108TO	The O-GlcNAc Database
91		26192747 33300544 40885482	G49108TO	The O-GlcNAc Database
94	N-linked (GlcNAc...) asparagine	30899004 6177036	G79666IR G82830MN G80223IX G23863VK G74430RZ G84820NF G64527OM G10256JP G50045TK G82119TF G05724UK G29880MM G39188ZX G94854LT G06110VR G66538GV G14669DU	GlycoProtDB UniProt GlyGen GlyConnect
110		26192747 33300544 40885482	G49108TO	The O-GlcNAc Database
118	N-linked (GlcNAc...) asparagine	30899004 6177036	G80223IX G25418HZ G46902YN G23294PN G65092SV G45504EY G84820NF G50045TK G82119TF G33609NS G06110VR G66538GV G63628AV	GlycoProtDB UniProt GlyGen GlyConnect