GlyCosmos Portal

Submissions

H-2 class II histocompatibility antigen, E-B beta chain

Summary

UniProt ID

P04230

Gene Symbol

H2-Eb1

Organism

Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0003274
GlyGen: P04230
Re-Glyco: P04230

Annotation

Keyword: 3D-structure Disulfide bond Glycoprotein MHC II Reference proteome Signal Transmembrane helix Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
adaptive immune response
peptide antigen assembly with MHC class II protein complex	IBA	GO_REF
antigen processing and presentation of exogenous peptide antigen via MHC class II	IDA	PMID PMID
antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA	GO_REF
positive regulation of immune response	IBA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

adaptive immune response

antigen processing and presentation [inference]

antigen processing and presentation of peptide or polysaccharide antigen via MHC class II [inference]

antigen processing and presentation of peptide antigen via MHC class II [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class II

antigen processing and presentation of exogenous antigen [inference]

antigen processing and presentation of exogenous peptide antigen [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class II

antigen processing and presentation of peptide antigen [inference]

antigen processing and presentation of exogenous peptide antigen [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class II

antigen processing and presentation of peptide antigen via MHC class II [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class II

cellular process [inference]

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

protein-containing complex assembly [inference]

peptide antigen assembly with MHC protein complex [inference]

peptide antigen assembly with MHC class II protein complex

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

peptide antigen assembly with MHC protein complex [inference]

peptide antigen assembly with MHC class II protein complex

response to stimulus [inference]

immune response [inference]

adaptive immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of immune response

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of T cell activation [inference]

positive regulation of T cell activation

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of immune response [inference]

positive regulation of immune response

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of immune response

positive regulation of cellular process [inference]

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of response to stimulus [inference]

positive regulation of immune response

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of response to stimulus [inference]

positive regulation of response to stimulus [inference]

positive regulation of immune response

regulation of immune response [inference]

positive regulation of immune response

regulation of cellular process [inference]

regulation of cell adhesion [inference]

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

positive regulation of cellular process [inference]

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of T cell activation [inference]

positive regulation of T cell activation

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of T cell activation [inference]

positive regulation of T cell activation

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
immunological synapse	ISO	GO_REF
lysosomal membrane	ISO	GO_REF
lysosomal membrane	IBA	GO_REF
plasma membrane	ISO	GO_REF
external side of plasma membrane	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

MHC protein complex [inference]

MHC class II protein complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane [inference]

late endosome membrane

bounding membrane of organelle [inference]

vacuolar membrane [inference]

lytic vacuole membrane [inference]

lysosomal membrane

endosome membrane [inference]

late endosome membrane

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
MHC class II protein complex binding	IBA	GO_REF
polysaccharide binding	ISO	GO_REF
MHC class II receptor activity
peptide antigen binding	ISO	GO_REF
peptide antigen binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

antigen binding [inference]

peptide antigen binding

protein binding [inference]

signaling receptor binding [inference]

carbohydrate binding [inference]

polysaccharide binding

peptide binding [inference]

peptide antigen binding

protein-containing complex binding [inference]

MHC protein complex binding [inference]

MHC class II protein complex binding

T cell receptor binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

MHC class II receptor activity

immune receptor activity [inference]

MHC class II receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVWLPRVPCVAAVILLLTVLSPPMALVRDSRPWFLEYCKSECHFYNGTQRVRLLERYFYNLEENLRFDSDVGEFHAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEISDKFLVRRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEWKAQSTSAQNKMLSGVGGFVLGLLFLGAGLFIYFRNQKGQSGLQPTGLLS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
46	N-linked (GlcNAc...) asparagine	3980466	G02815KT	GlycoProtDB UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Downstream TCR signaling	Mus musculus
Generation of second messenger molecules	Mus musculus
MHC class II antigen presentation	Mus musculus
PD-1 signaling	Mus musculus
Phosphorylation of CD3 and TCR zeta chains	Mus musculus
Translocation of ZAP-70 to Immunological synapse	Mus musculus