GlyCosmos Portal

Submissions

Proto-oncogene Wnt-1

Summary

UniProt ID

P04628

Gene Symbol

INT1
WNT1

Gene ID

7471

Organism

Homo sapiens (human)

External Links

PubChem: P04628
Re-Glyco: P04628

Annotation

Keyword: Developmental protein Disease variant Disulfide bond Extracellular matrix Glycoprotein Lipoprotein Osteogenesis imperfecta Osteoporosis Proteomics identification Proto-oncogene Reference proteome Signal Wnt signaling pathway

Gene Ontology (GO)

Displaying entries **1 - 5** of 70 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
embryonic axis specification	ISS	GO_REF
embryonic axis specification	IEA	GO_REF
branching involved in ureteric bud morphogenesis
cell-cell signaling	ISS	GO_REF
cell-cell signaling	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

T cell activation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

T cell activation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

cell communication [inference]

cell-cell signaling

glial cell-neuron signaling [inference]

astrocyte-dopaminergic neuron signaling

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

canonical Wnt signaling pathway

intracellular signal transduction [inference]

signal transduction in response to DNA damage

cell population proliferation [inference]

neural precursor cell proliferation [inference]

cell proliferation in midbrain

stem cell proliferation [inference]

hematopoietic stem cell proliferation

cellular developmental process [inference]

cell fate determination [inference]

neuron fate determination

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

cell differentiation in spinal cord [inference]

spinal cord association neuron differentiation

neuron differentiation

central nervous system neuron differentiation [inference]

dopaminergic neuron differentiation [inference]

midbrain dopaminergic neuron differentiation

epithelial cell differentiation [inference]

hepatocyte differentiation

fat cell differentiation

cell fate commitment

cellular response to stimulus [inference]

cellular response to stress [inference]

DNA damage response [inference]

signal transduction in response to DNA damage

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus

cell-cell fusion [inference]

syncytium formation by cell-cell fusion [inference]

myoblast fusion

multicellular organismal process [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in ureteric bud morphogenesis

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

T cell activation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

pattern specification process [inference]

regionalization [inference]

anterior/posterior pattern specification [inference]

forebrain anterior/posterior pattern specification

axis specification [inference]

embryonic axis specification

embryonic pattern specification [inference]

embryonic axis specification

midbrain-hindbrain boundary maturation during brain development

developmental process [inference]

anatomical structure morphogenesis [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in ureteric bud morphogenesis

central nervous system morphogenesis

tube morphogenesis [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in ureteric bud morphogenesis

embryonic morphogenesis [inference]

inner ear morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in ureteric bud morphogenesis

anatomical structure formation involved in morphogenesis [inference]

anatomical structure development [inference]

regeneration [inference]

animal organ regeneration

animal organ development [inference]

animal organ regeneration

embryonic organ development [inference]

embryonic brain development

bone development

cellular developmental process [inference]

cell fate determination [inference]

neuron fate determination

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

cell differentiation in spinal cord [inference]

spinal cord association neuron differentiation

neuron differentiation

central nervous system neuron differentiation [inference]

dopaminergic neuron differentiation [inference]

midbrain dopaminergic neuron differentiation

epithelial cell differentiation [inference]

hepatocyte differentiation

fat cell differentiation

cell fate commitment

response to stimulus [inference]

response to stress [inference]

response to wounding

cellular response to stress [inference]

DNA damage response [inference]

signal transduction in response to DNA damage

response to endogenous stimulus [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus

response to peptide hormone [inference]

cellular response to peptide hormone stimulus

cellular response to endogenous stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus

response to chemical [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus

response to peptide hormone [inference]

cellular response to peptide hormone stimulus

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus

response to nitrogen compound [inference]

response to peptide hormone [inference]

cellular response to peptide hormone stimulus

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus

response to oxygen-containing compound [inference]

response to peptide hormone [inference]

cellular response to peptide hormone stimulus

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus

cellular response to stimulus [inference]

cellular response to stress [inference]

DNA damage response [inference]

signal transduction in response to DNA damage

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of Notch signaling pathway [inference]

positive regulation of Notch signaling pathway

positive regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of insulin-like growth factor receptor signaling pathway [inference]

positive regulation of insulin-like growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

signaling [inference]

cell-cell signaling

glial cell-neuron signaling [inference]

astrocyte-dopaminergic neuron signaling

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of fibroblast proliferation

positive regulation of stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of lamellipodium organization [inference]

positive regulation of lamellipodium assembly

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of developmental process [inference]

positive regulation of embryonic development [inference]

positive regulation of dermatome development

positive regulation of multicellular organismal process [inference]

positive regulation of embryonic development [inference]

positive regulation of dermatome development

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of neuron apoptotic process [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of fat cell differentiation

negative regulation of cellular senescence

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of BMP signaling pathway

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of fat cell differentiation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of Notch signaling pathway [inference]

positive regulation of Notch signaling pathway

positive regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of insulin-like growth factor receptor signaling pathway [inference]

positive regulation of insulin-like growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of BMP signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of BMP signaling pathway

regulation of cellular response to transforming growth factor beta stimulus [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

regulation of developmental process [inference]

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of fat cell differentiation

regulation of fat cell differentiation [inference]

negative regulation of fat cell differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of fat cell differentiation

positive regulation of developmental process [inference]

positive regulation of embryonic development [inference]

positive regulation of dermatome development

regulation of dermatome development [inference]

positive regulation of dermatome development

regulation of multicellular organismal development [inference]

regulation of embryonic development [inference]

positive regulation of embryonic development [inference]

positive regulation of dermatome development

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

canonical Wnt signaling pathway

intracellular signal transduction [inference]

signal transduction in response to DNA damage

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of Notch signaling pathway [inference]

positive regulation of Notch signaling pathway

positive regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of insulin-like growth factor receptor signaling pathway [inference]

positive regulation of insulin-like growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

regulation of ubiquitin-dependent protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

regulation of ubiquitin-dependent protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

regulation of ubiquitin-dependent protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

regulation of cell-substrate adhesion [inference]

negative regulation of cell-substrate adhesion

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of fibroblast proliferation

positive regulation of stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

regulation of fibroblast proliferation [inference]

positive regulation of fibroblast proliferation

regulation of stem cell proliferation [inference]

regulation of hematopoietic stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

positive regulation of stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of neuron apoptotic process [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of neuron apoptotic process [inference]

negative regulation of neuron apoptotic process [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of neuron apoptotic process [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of cellular component biogenesis [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of lamellipodium assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of fat cell differentiation

regulation of fat cell differentiation [inference]

negative regulation of fat cell differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of fibroblast proliferation

positive regulation of stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of lamellipodium organization [inference]

positive regulation of lamellipodium assembly

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of ubiquitin-dependent protein catabolic process

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of neuron apoptotic process [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of fat cell differentiation

negative regulation of cellular senescence

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of lamellipodium organization [inference]

positive regulation of lamellipodium assembly

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of lamellipodium assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

regulation of plasma membrane bounded cell projection organization [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

regulation of lamellipodium assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

regulation of lamellipodium organization [inference]

regulation of lamellipodium assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of lamellipodium organization [inference]

positive regulation of lamellipodium assembly

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of lamellipodium assembly

positive regulation of lamellipodium organization [inference]

positive regulation of lamellipodium assembly

regulation of cellular senescence [inference]

negative regulation of cellular senescence

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of embryonic development [inference]

positive regulation of dermatome development

regulation of multicellular organismal development [inference]

regulation of embryonic development [inference]

positive regulation of embryonic development [inference]

positive regulation of dermatome development

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	EXP	PMID
extracellular region	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome
extracellular region	IEA	GO_REF GO_REF GO_REF GO_REF
obsolete extracellular space
cytoplasm	IDA	PMID PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endocytic vesicle membrane

bounding membrane of organelle [inference]

endocytic vesicle membrane

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
frizzled binding	NAS	PMID
frizzled binding	IC	PMID
frizzled binding	IBA	GO_REF
cytokine activity	ISS	GO_REF
cytokine activity	IDA	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

G protein-coupled receptor binding [inference]

frizzled binding

protein domain specific binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
29	N-linked (GlcNAc...) asparagine	UniProt
316	N-linked (GlcNAc...) asparagine	UniProt
346	N-linked (GlcNAc...) asparagine	UniProt
359	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Class B/2 (Secretin family receptors)	Homo sapiens
Disassembly of the destruction complex and recruitment of AXIN to the membrane	Homo sapiens
PCP/CE pathway	Homo sapiens
TCF dependent signaling in response to WNT	Homo sapiens
Transcriptional regulation of white adipocyte differentiation	Homo sapiens
WNT ligand biogenesis and trafficking	Homo sapiens

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0110347	osteogenesis imperfecta type 15	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements