GlyCosmos Portal

Submissions

Serglycin

Summary

UniProt ID: P04917
Gene Symbol: Srgn Pgsg Prg Prg1
Gene ID: 56782
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: P04917
Re-Glyco: P04917

Annotation

Keyword: Apoptosis Biomineralization Direct protein sequencing Disulfide bond Golgi apparatus Lysosome Proteoglycan Reference proteome Repeat Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of cytokine production	ISS	GO_REF
negative regulation of cytokine production	ISO	GO_REF
apoptotic process
protein processing	ISS	GO_REF
protein processing	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

granzyme-mediated programmed cell death signaling pathway

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing

protein maturation [inference]

protein processing

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing

protein maturation [inference]

protein processing

cell death [inference]

programmed cell death [inference]

apoptotic process

maintenance of location in cell [inference]

maintenance of protein location in cell [inference]

maintenance of protein location in mast cell secretory granule [inference]

maintenance of protease location in mast cell secretory granule

maintenance of protein location in T cell secretory granule [inference]

maintenance of protease location in T cell secretory granule [inference]

maintenance of granzyme B location in T cell secretory granule

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

vesicle organization [inference]

secretory granule organization

developmental process [inference]

anatomical structure development [inference]

tissue development [inference]

biomineral tissue development

localization [inference]

maintenance of location [inference]

maintenance of protein location [inference]

maintenance of protein location in cell [inference]

maintenance of protein location in mast cell secretory granule [inference]

maintenance of protease location in mast cell secretory granule

maintenance of protein location in T cell secretory granule [inference]

maintenance of protease location in T cell secretory granule [inference]

maintenance of granzyme B location in T cell secretory granule

maintenance of location in cell [inference]

maintenance of protein location in cell [inference]

maintenance of protein location in mast cell secretory granule [inference]

maintenance of protease location in mast cell secretory granule

maintenance of protein location in T cell secretory granule [inference]

maintenance of protease location in T cell secretory granule [inference]

maintenance of granzyme B location in T cell secretory granule

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of developmental process [inference]

negative regulation of biomineral tissue development [inference]

negative regulation of bone mineralization

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production

negative regulation of ossification [inference]

negative regulation of bone mineralization

regulation of developmental process [inference]

negative regulation of developmental process [inference]

negative regulation of biomineral tissue development [inference]

negative regulation of bone mineralization

regulation of multicellular organismal development [inference]

regulation of biomineral tissue development [inference]

regulation of bone mineralization [inference]

negative regulation of bone mineralization

negative regulation of biomineral tissue development [inference]

negative regulation of bone mineralization

regulation of cellular process [inference]

signal transduction [inference]

granzyme-mediated programmed cell death signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production

regulation of ossification [inference]

negative regulation of ossification [inference]

negative regulation of bone mineralization

regulation of bone mineralization [inference]

negative regulation of bone mineralization

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production

negative regulation of ossification [inference]

negative regulation of bone mineralization

regulation of multicellular organismal development [inference]

regulation of biomineral tissue development [inference]

regulation of bone mineralization [inference]

negative regulation of bone mineralization

negative regulation of biomineral tissue development [inference]

negative regulation of bone mineralization

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	IDA	PMID
obsolete extracellular space
Golgi apparatus	ISS	GO_REF
Golgi apparatus	ISO	GO_REF
Golgi apparatus	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule

zymogen granule

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome [inference]

Golgi apparatus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule

zymogen granule

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome [inference]

Golgi apparatus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule

zymogen granule

Displaying 1 entry
GO Term	Evidence Code	Reference
collagen binding	IDA	PMID

GO Hierarchy

molecular function

binding [inference]

protein-containing complex binding [inference]

collagen binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRQVPVGTRLVLALAFVLVWGSSVQGYPARRARYQWVRCKPDGIFANCIEEKGPRFDLIAEESNVGPPMTDPVLMRGFPNDFFPISDDYSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSLADMEWEYQPTDENNIVYFNYGPFDRMLTEQNQEQPGDFII

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 8** entries
Position	Description	Source
90	O-linked (Xyl...) (glycosaminoglycan) serine	UniProt
92	O-linked (Xyl...) (glycosaminoglycan) serine	UniProt
96	O-linked (Xyl...) (glycosaminoglycan) serine	UniProt
98	O-linked (Xyl...) (glycosaminoglycan) serine	UniProt
100	O-linked (Xyl...) (glycosaminoglycan) serine	UniProt
102	O-linked (Xyl...) (glycosaminoglycan) serine	UniProt
104	O-linked (Xyl...) (glycosaminoglycan) serine	UniProt
106	O-linked (Xyl...) (glycosaminoglycan) serine	UniProt