GlyCosmos Portal

Submissions

Sodium/potassium-transporting ATPase subunit beta-1

Summary

UniProt ID: P07340
Gene Symbol: Atp1b1
Gene ID: 25650
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: P07340
PubChem: P07340
RaftProt: P07340
Re-Glyco: P07340

Annotation

Keyword: 3D-structure Cell adhesion Cell membrane Direct protein sequencing Disulfide bond Glutathionylation Glycoprotein Innate immunity Phosphoprotein Reference proteome Signal-anchor Sodium/potassium transport Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 49 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
response to hypoxia	IDA	PMID
potassium ion transport	IDA	PMID
potassium ion transport	IEA	GO_REF
sodium ion transport	IDA	PMID
sodium ion transport	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

innate immune response

cellular process [inference]

cell adhesion

signal transduction [inference]

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

calcium-mediated signaling [inference]

regulation of cardiac muscle contraction by calcium ion signaling

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process

small molecule metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

ATP metabolic process

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to plasma membrane

transmembrane transport

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport

sodium ion export across plasma membrane

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

potassium ion import across plasma membrane

export across plasma membrane [inference]

sodium ion export across plasma membrane

export from cell [inference]

export across plasma membrane [inference]

sodium ion export across plasma membrane

multicellular organismal process [inference]

system process [inference]

muscle system process [inference]

muscle contraction [inference]

striated muscle contraction [inference]

cardiac muscle contraction

relaxation of muscle [inference]

relaxation of cardiac muscle

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis

potassium ion homeostasis [inference]

intracellular potassium ion homeostasis

sodium ion homeostasis [inference]

intracellular sodium ion homeostasis

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

inorganic ion homeostasis [inference]

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis

potassium ion homeostasis [inference]

intracellular potassium ion homeostasis

sodium ion homeostasis [inference]

intracellular sodium ion homeostasis

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

response to hypoxia

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to abiotic stimulus [inference]

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein localization to membrane [inference]

protein localization to plasma membrane

protein localization to cell periphery [inference]

protein localization to plasma membrane

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport

potassium ion transport

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

sodium ion transport

sodium ion transmembrane transport

sodium ion export across plasma membrane

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport

sodium ion export across plasma membrane

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport

sodium ion export across plasma membrane

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

transmembrane transport

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport

sodium ion export across plasma membrane

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

potassium ion import across plasma membrane

export across plasma membrane [inference]

sodium ion export across plasma membrane

import into cell [inference]

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

potassium ion import across plasma membrane

export from cell [inference]

export across plasma membrane [inference]

sodium ion export across plasma membrane

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to plasma membrane

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of transmembrane transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of monoatomic cation transmembrane transport [inference]

regulation of potassium ion transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

regulation of potassium ion import [inference]

positive regulation of potassium ion import across plasma membrane

regulation of sodium ion transmembrane transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of sodium ion export across plasma membrane [inference]

positive regulation of sodium ion export across plasma membrane

regulation of calcium ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of sodium ion transport [inference]

positive regulation of sodium ion transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of sodium ion transmembrane transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of sodium ion export across plasma membrane [inference]

positive regulation of sodium ion export across plasma membrane

regulation of potassium ion transport [inference]

positive regulation of potassium ion transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

regulation of potassium ion transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

regulation of potassium ion import [inference]

positive regulation of potassium ion import across plasma membrane

regulation of calcium ion transport [inference]

regulation of calcium ion transmembrane transport

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of monoatomic cation transmembrane transport [inference]

regulation of potassium ion transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

regulation of potassium ion import [inference]

positive regulation of potassium ion import across plasma membrane

regulation of sodium ion transmembrane transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of sodium ion export across plasma membrane [inference]

positive regulation of sodium ion export across plasma membrane

regulation of calcium ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of monoatomic ion transport [inference]

positive regulation of sodium ion transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of potassium ion transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of monoatomic ion transport [inference]

positive regulation of sodium ion transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of potassium ion transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of monoatomic ion transport [inference]

positive regulation of sodium ion transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of potassium ion transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

calcium-mediated signaling [inference]

regulation of cardiac muscle contraction by calcium ion signaling

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of transmembrane transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of monoatomic cation transmembrane transport [inference]

regulation of potassium ion transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

regulation of potassium ion import [inference]

positive regulation of potassium ion import across plasma membrane

regulation of sodium ion transmembrane transport [inference]

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of sodium ion export across plasma membrane [inference]

positive regulation of sodium ion export across plasma membrane

regulation of calcium ion transmembrane transport

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

positive regulation of cellular process [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of potassium ion transmembrane transport

positive regulation of potassium ion import across plasma membrane

positive regulation of sodium ion transmembrane transport

positive regulation of sodium ion export across plasma membrane

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of muscle system process [inference]

regulation of muscle contraction [inference]

regulation of striated muscle contraction [inference]

regulation of cardiac muscle contraction [inference]

regulation of cardiac muscle contraction by calcium ion signaling

regulation of blood circulation [inference]

regulation of heart contraction [inference]

regulation of cardiac muscle contraction [inference]

regulation of cardiac muscle contraction by calcium ion signaling

regulation of biological quality [inference]

regulation of protein stability [inference]

protein stabilization

regulation of membrane potential [inference]

membrane repolarization

Displaying entries **1 - 5** of 27 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	ISO	GO_REF
plasma membrane	IEA	GO_REF GO_REF
sodium:potassium-exchanging ATPase complex	ISO	GO_REF
sodium:potassium-exchanging ATPase complex	IDA	PMID PMID
sodium:potassium-exchanging ATPase complex	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

sodium:potassium-exchanging ATPase complex

transmembrane transporter complex [inference]

ATPase dependent transmembrane transport complex [inference]

cation-transporting ATPase complex [inference]

sodium:potassium-exchanging ATPase complex

transporter complex [inference]

transmembrane transporter complex [inference]

ATPase dependent transmembrane transport complex [inference]

cation-transporting ATPase complex [inference]

sodium:potassium-exchanging ATPase complex

cellular anatomical structure [inference]

membrane

plasma membrane

sarcolemma

organelle membrane

plasma membrane region [inference]

plasma membrane raft [inference]

caveola

membrane microdomain [inference]

membrane raft [inference]

plasma membrane raft [inference]

caveola

lateral plasma membrane

cell junction [inference]

anchoring junction [inference]

cell-cell junction [inference]

cell-cell contact zone [inference]

intercalated disc

T-tubule

cell projection [inference]

plasma membrane bounded cell projection [inference]

cilium [inference]

motile cilium [inference]

9+2 motile cilium [inference]

sperm flagellum

organelle [inference]

membrane-bounded organelle [inference]

cilium [inference]

motile cilium [inference]

9+2 motile cilium [inference]

sperm flagellum

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
ATPase activator activity	ISO	GO_REF
ATPase activator activity	IBA	GO_REF
ATPase activator activity	IEA	GO_REF
P-type sodium:potassium-exchanging transporter activity	ISO	GO_REF
P-type sodium:potassium-exchanging transporter activity	IDA	PMID

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

metal ion transmembrane transporter activity [inference]

potassium ion transmembrane transporter activity [inference]

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

sodium ion transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

active monoatomic ion transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

active transmembrane transporter activity [inference]

primary active transmembrane transporter activity [inference]

active monoatomic ion transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

ATPase-coupled transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type transmembrane transporter activity [inference]

P-type ion transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

kinase binding [inference]

protein kinase binding

ATPase binding

protein dimerization activity [inference]

protein heterodimerization activity

molecular adaptor activity [inference]

protein-macromolecule adaptor activity

molecular function regulator activity [inference]

molecular function activator activity [inference]

transporter regulator activity [inference]

transporter activator activity

ATP-dependent activity [inference]

ATPase-coupled transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type transmembrane transporter activity [inference]

P-type ion transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGSMPSEPKERGEFNHERGERKVCRFKLDWLGNCSGLNDESYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPLTMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGFYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTLDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
158	N-linked (GlcNAc...) asparagine	24090084 34106099	G46177TS G09406IK G72961RM G93526NJ G44953PJ G10820KD G19379ID G82753OZ G23295TF G54600FO G63787RZ G68937TM G60230HH G80920RR G55382TU G99952ON G21361AZ G68318VE G48975GN G50073PQ G97459BD G14548ZL G62765YT G03930BU G11535IB G72790NZ G30159WR G88725PI G61855PQ G49955PK G25987BV G82680EC	UniProt GlyGen
193	N-linked (GlcNAc...) asparagine	24090084	G06704MH G98544EX G65225MN G48149UR G21670TV G84320LV G49035CH G19517GM G04784US G64916EE G84492TS G12580WI G47737VJ G69364JQ G19379ID G80920RR G62765YT G31852PQ G41247ZX	UniProt GlyGen
266	N-linked (GlcNAc...) asparagine			UniProt GlyGen