GlyCosmos Portal

Submissions

Complement component C8 beta chain

Summary

UniProt ID: P07358
Gene Symbol: C8B hCG_23458
Gene ID: 732
Organism: Homo sapiens (human)

External Links

GlycoProtDB

GPDB0011420

GlyConnect

Complement component C8 beta chain

GlyGen

P07358

PubChem

P07358

Re-Glyco

P07358

Annotation

Keyword: 3D-structure Complement alternate pathway Direct protein sequencing Disulfide bond EGF-like domain Glycoprotein Membrane attack complex Phosphoprotein Proteomics identification Reference proteome Repeat Secreted Signal Target cell membrane Transmembrane beta strand

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
immune response	TAS	PMID
immune response	IEA	GO_REF
complement activation	TAS	PMID
complement activation	IDA	PMID PMID PMID PMID PMID
complement activation	IBA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

complement activation

activation of immune response [inference]

complement activation

immune response

humoral immune response [inference]

complement activation

innate immune response [inference]

cellular process [inference]

cell killing [inference]

killing of cells of another organism

transmembrane transport

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

disruption of anatomical structure in another organism [inference]

disruption of cell in another organism [inference]

killing of cells of another organism

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

immune response

humoral immune response [inference]

complement activation

innate immune response [inference]

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

localization [inference]

establishment of localization [inference]

transport [inference]

transmembrane transport

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response

activation of immune response [inference]

complement activation

regulation of immune response [inference]

positive regulation of immune response

activation of immune response [inference]

complement activation

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response

activation of immune response [inference]

complement activation

positive regulation of response to stimulus [inference]

positive regulation of immune response

activation of immune response [inference]

complement activation

regulation of response to stimulus [inference]

positive regulation of response to stimulus [inference]

positive regulation of immune response

activation of immune response [inference]

complement activation

regulation of immune response [inference]

positive regulation of immune response

activation of immune response [inference]

complement activation

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	EXP	PMID PMID
extracellular region	TAS	Reactome Reactome Reactome Reactome Reactome
extracellular region	IEA	GO_REF GO_REF GO_REF
membrane attack complex	IDA	PMID PMID PMID PMID PMID PMID
membrane attack complex	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

pore complex [inference]

membrane attack complex

plasma membrane protein complex [inference]

membrane attack complex

cellular anatomical structure [inference]

extracellular region

membrane

plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle

extracellular exosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle

extracellular exosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle

extracellular exosome

other organism part [inference]

other organism cell membrane

Displaying 1 entry
GO Term	Evidence Code	Reference
protein-containing complex binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein-containing complex binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTLMPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCGSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
70	C-linked (Man) tryptophan	10551839		UniProt GlyGen
73	C-linked (Man) tryptophan	10551839		UniProt GlyGen
101	N-linked (GlcNAc...) asparagine			UniProt GlyGen
243	N-linked (GlcNAc...) asparagine	16335952 19159218 23090970 29671580 29741879 30552328 37074911	G94470IW G26330YA G40574BA G08918WF G00912UN G48414YA G27126ED G70619PT G06356OH G59626AS G45504EY G10486CT G95865ZB G35029YA	GlycoProtDB UniProt GlyGen GlyConnect
551	C-linked (Man) tryptophan	10551839		UniProt GlyGen
554	C-linked (Man) tryptophan	10551839		UniProt GlyGen