GlyCosmos Portal

Submissions

Adenine phosphoribosyltransferase

Summary

UniProt ID: P07741
Gene Symbol: APRT
Gene ID: 353
Organism: Homo sapiens (human)

External Links

GlyGen: P07741
PubChem: P07741
The Human Metabolome Database: HMDBP00438
RaftProt: P07741
Re-Glyco: P07741

Annotation

Keyword: 3D-structure Acetylation Alternative splicing Cytoplasm Direct protein sequencing Disease variant Glycosyltransferase Phosphoprotein Proteomics identification Purine salvage Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
purine ribonucleoside salvage
adenine salvage	IBA	GO_REF
adenine salvage	IEA	GO_REF
grooming behavior
GMP salvage	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

biosynthetic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleobase-containing small molecule biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleoside salvage [inference]

purine ribonucleoside salvage

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

metabolic compound salvage [inference]

purine-containing compound salvage [inference]

purine ribonucleoside salvage

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

purine nucleobase salvage [inference]

adenine salvage

nucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

nucleoside salvage [inference]

purine ribonucleoside salvage

small molecule biosynthetic process [inference]

nucleobase-containing small molecule biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleoside salvage [inference]

purine ribonucleoside salvage

nucleobase biosynthetic process [inference]

purine nucleobase biosynthetic process [inference]

purine nucleobase salvage [inference]

adenine salvage

adenine biosynthetic process [inference]

adenine salvage

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

purine nucleobase biosynthetic process [inference]

purine nucleobase salvage [inference]

adenine salvage

adenine biosynthetic process [inference]

adenine salvage

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

purine-containing compound salvage [inference]

purine ribonucleoside salvage

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

purine nucleobase salvage [inference]

adenine salvage

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

glycosyl compound biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleoside salvage [inference]

purine ribonucleoside salvage

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleobase-containing small molecule biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleoside salvage [inference]

purine ribonucleoside salvage

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

nucleobase metabolic process [inference]

purine nucleobase metabolic process [inference]

purine nucleobase biosynthetic process [inference]

purine nucleobase salvage [inference]

adenine salvage

adenine biosynthetic process [inference]

adenine salvage

adenine metabolic process [inference]

adenine biosynthetic process [inference]

adenine salvage

nucleobase biosynthetic process [inference]

purine nucleobase biosynthetic process [inference]

purine nucleobase salvage [inference]

adenine salvage

adenine biosynthetic process [inference]

adenine salvage

nucleoside metabolic process [inference]

ribonucleoside metabolic process [inference]

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

purine ribonucleoside metabolic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleoside salvage [inference]

purine ribonucleoside salvage

purine nucleoside metabolic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

purine ribonucleoside metabolic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleobase-containing small molecule biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleoside salvage [inference]

purine ribonucleoside salvage

small molecule metabolic process [inference]

small molecule biosynthetic process [inference]

nucleobase-containing small molecule biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleoside salvage [inference]

purine ribonucleoside salvage

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

nucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

nucleobase metabolic process [inference]

purine nucleobase metabolic process [inference]

purine nucleobase biosynthetic process [inference]

purine nucleobase salvage [inference]

adenine salvage

adenine biosynthetic process [inference]

adenine salvage

adenine metabolic process [inference]

adenine biosynthetic process [inference]

adenine salvage

nucleobase biosynthetic process [inference]

purine nucleobase biosynthetic process [inference]

purine nucleobase salvage [inference]

adenine salvage

adenine biosynthetic process [inference]

adenine salvage

nucleoside metabolic process [inference]

ribonucleoside metabolic process [inference]

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

purine ribonucleoside metabolic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleoside salvage [inference]

purine ribonucleoside salvage

purine nucleoside metabolic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

purine ribonucleoside metabolic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleobase-containing small molecule biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleoside salvage [inference]

purine ribonucleoside salvage

purine-containing compound metabolic process [inference]

purine nucleobase metabolic process [inference]

purine nucleobase biosynthetic process [inference]

purine nucleobase salvage [inference]

adenine salvage

adenine biosynthetic process [inference]

adenine salvage

adenine metabolic process [inference]

adenine biosynthetic process [inference]

adenine salvage

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

purine nucleoside metabolic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

purine ribonucleoside metabolic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

purine nucleobase biosynthetic process [inference]

purine nucleobase salvage [inference]

adenine salvage

adenine biosynthetic process [inference]

adenine salvage

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

purine-containing compound salvage [inference]

purine ribonucleoside salvage

purine nucleotide salvage [inference]

purine ribonucleotide salvage [inference]

purine nucleobase salvage [inference]

adenine salvage

carbohydrate derivative metabolic process [inference]

nucleoside metabolic process [inference]

ribonucleoside metabolic process [inference]

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

purine ribonucleoside metabolic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleoside salvage [inference]

purine ribonucleoside salvage

purine nucleoside metabolic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

purine ribonucleoside metabolic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

AMP metabolic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP metabolic process [inference]

GMP biosynthetic process [inference]

GMP salvage

IMP metabolic process [inference]

IMP biosynthetic process [inference]

IMP salvage

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

AMP salvage

GMP biosynthetic process [inference]

GMP salvage

IMP biosynthetic process [inference]

IMP salvage

purine ribonucleotide salvage [inference]

glycosyl compound biosynthetic process [inference]

nucleoside biosynthetic process [inference]

purine nucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

ribonucleoside biosynthetic process [inference]

purine ribonucleoside biosynthetic process [inference]

purine ribonucleoside salvage

nucleoside salvage [inference]

purine ribonucleoside salvage

multicellular organismal process [inference]

behavior [inference]

grooming behavior

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	TAS	Reactome
nucleoplasm
cytoplasm	TAS	PMID
cytoplasm	IBA	GO_REF
cytoplasm	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane-enclosed lumen [inference]

organelle lumen [inference]

vesicle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen

intracellular organelle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
adenine binding	IBA	GO_REF
adenine binding	IEA	GO_REF
adenine phosphoribosyltransferase activity	TAS	PMID
adenine phosphoribosyltransferase activity	IDA	PMID
adenine phosphoribosyltransferase activity	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

pentosyltransferase activity [inference]

purine phosphoribosyltransferase activity [inference]

adenine phosphoribosyltransferase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

AMP binding

cation binding [inference]

AMP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

AMP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

AMP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

AMP binding

nucleobase binding [inference]

purine nucleobase binding [inference]

adenine binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

AMP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

AMP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

AMP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

AMP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
21				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Defective APRT disrupts adenine salvage	Homo sapiens
Neutrophil degranulation	Homo sapiens
Purine salvage	Homo sapiens

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0060350	adenine phosphoribosyltransferase deficiency	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements