GlyCosmos Portal

Submissions

Chymase

Summary

UniProt ID: P21844
Gene Symbol: Cma1 Mcpt5
Gene ID: 17228
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0003482
PubChem: P21844
Re-Glyco: P21844

Annotation

Keyword: Direct protein sequencing Disulfide bond Glycoprotein Reference proteome Secreted Serine protease Signal Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
protein processing	ISO	GO_REF
extracellular matrix disassembly	ISO	GO_REF
protein catabolic process	ISO	GO_REF
basement membrane disassembly	ISO	GO_REF
positive regulation of angiogenesis	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

protein metabolic process [inference]

proteolysis [inference]

protein processing

signaling receptor ligand precursor processing [inference]

cytokine precursor processing

protein catabolic process

protein maturation

protein processing

signaling receptor ligand precursor processing [inference]

cytokine precursor processing

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing

signaling receptor ligand precursor processing [inference]

cytokine precursor processing

protein catabolic process

protein maturation

protein processing

signaling receptor ligand precursor processing [inference]

cytokine precursor processing

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component disassembly [inference]

extracellular matrix disassembly

basement membrane disassembly

extracellular structure organization [inference]

extracellular matrix organization [inference]

extracellular matrix disassembly

basement membrane disassembly

basement membrane organization [inference]

basement membrane disassembly

external encapsulating structure organization [inference]

extracellular matrix organization [inference]

extracellular matrix disassembly

basement membrane disassembly

basement membrane organization [inference]

basement membrane disassembly

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

regulation of inflammatory response

regulation of response to stress [inference]

regulation of defense response [inference]

regulation of inflammatory response

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISO	GO_REF
extracellular region	IEA	GO_REF
obsolete extracellular space
cytosol	ISO	GO_REF
secretory granule	ISO	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule

membraneless organelle [inference]

intracellular membraneless organelle [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule

intracellular membraneless organelle [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule

supramolecular complex [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
endopeptidase activity	ISO	GO_REF
serine-type endopeptidase activity	ISO	GO_REF GO_REF
serine-type endopeptidase activity	IBA	GO_REF
serine-type endopeptidase activity	IEA	GO_REF GO_REF GO_REF
serine-type peptidase activity	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity

serine-type endopeptidase activity

serine-type peptidase activity

serine-type endopeptidase activity

serine hydrolase activity [inference]

serine-type peptidase activity

serine-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity

serine-type endopeptidase activity

serine-type peptidase activity

serine-type endopeptidase activity

binding [inference]

peptide binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MHLLTLHLLLLLLGSSTKAGEIIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILREN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
80	N-linked (GlcNAc...) asparagine			GlycoProtDB UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Activation of Matrix Metalloproteinases	Mus musculus
Metabolism of Angiotensinogen to Angiotensins	Mus musculus
Signaling by SCF-KIT	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements