GlyCosmos Portal

Submissions

Genome polyprotein

Summary

UniProt ID: P27958
Gene Symbol
Organism: Hepatitis C virus (isolate H77)

External Links

GlyGen: P27958
PubChem: P27958
Re-Glyco: P27958

Annotation

Keyword: 3D-structure Acetylation Activation of host autophagy by virus Apoptosis Capsid protein Clathrin-mediated endocytosis of virus by host Direct protein sequencing Disulfide bond Fusion of virus membrane with host endosomal membrane G1/S host cell cycle checkpoint dysregulation by virus Glycoprotein Helicase Host cell membrane Host cytoplasm Host endoplasmic reticulum Host lipid droplet Host mitochondrion Host nucleus Inhibition of host MAVS by virus Inhibition of host STAT1 by virus Inhibition of host TRAFs by virus Isopeptide bond Magnesium Metal-binding Multifunctional enzyme Oncogene Palmitate Phosphoprotein RNA-binding RNA-directed RNA polymerase Reference proteome Ribonucleoprotein Ribosomal frameshifting SH3-binding Serine protease Thiol protease Transcription regulation Transmembrane helix Ubl conjugation Viral RNA replication Viral attachment to host adhesion receptor Viral attachment to host entry receptor Viral envelope protein Viral ion channel Viral nucleoprotein Zinc

Gene Ontology (GO)

Displaying entries **11 - 15** of 27 in total

« First

‹ Prev

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
symbiont-mediated activation of host autophagy	IEA	GO_REF
symbiont-mediated suppression of host TRAF-mediated signal transduction	IEA	GO_REF
symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity	TAS	PMID
symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity	IEA	GO_REF
symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT activity	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

viral RNA genome replication

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

viral RNA genome replication

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

viral RNA genome replication

protein metabolic process [inference]

proteolysis

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

viral RNA genome replication

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

viral RNA genome replication

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

viral RNA genome replication

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

viral RNA genome replication

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

viral RNA genome replication

protein metabolic process [inference]

proteolysis

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor-mediated endocytosis of virus by host cell [inference]

clathrin-dependent endocytosis of virus by host cell

clathrin-dependent endocytosis [inference]

clathrin-dependent endocytosis of virus by host cell

transmembrane transport [inference]

monoatomic ion transmembrane transport

viral process [inference]

viral capsid assembly

viral genome replication [inference]

viral RNA genome replication

membrane fusion involved in viral entry into host cell [inference]

fusion of virus membrane with host endosome membrane

viral translational frameshifting

biological process involved in interspecies interaction between organisms [inference]

modulation of process of another organism [inference]

symbiont-mediated perturbation of host process [inference]

symbiont-mediated perturbation of host cellular process

symbiont-mediated transformation of host cell

symbiont-mediated perturbation of host cell cycle progression [inference]

symbiont-mediated perturbation of host cell cycle G1/S transition checkpoint

symbiont-mediated perturbation of host signal transduction pathway [inference]

symbiont-mediated suppression of host signal transduction pathway [inference]

symbiont-mediated suppression of host JAK-STAT cascade [inference]

symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT activity

symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT1 activity

symbiont-mediated suppression of host TRAF-mediated signal transduction

symbiont-mediated suppression of host pathogen-associated molecular pattern receptor signaling pathway [inference]

symbiont-mediated suppression of cytoplasmic pattern recognition receptor signaling pathway [inference]

symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity

symbiont-mediated suppression of host interferon-mediated signaling pathway [inference]

symbiont-mediated suppression of host type I interferon-mediated signaling pathway

symbiont-mediated perturbation of host autophagy [inference]

symbiont-mediated activation of host autophagy

symbiont-mediated perturbation of host defense response [inference]

symbiont-mediated perturbation of host immune response [inference]

symbiont-mediated perturbation of host innate immune response [inference]

symbiont-mediated suppression of host innate immune response [inference]

symbiont-mediated suppression of host pathogen-associated molecular pattern receptor signaling pathway [inference]

symbiont-mediated suppression of cytoplasmic pattern recognition receptor signaling pathway [inference]

symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity

symbiont-mediated suppression of host immune response [inference]

symbiont-mediated suppression of host innate immune response [inference]

symbiont-mediated suppression of host pathogen-associated molecular pattern receptor signaling pathway [inference]

symbiont-mediated suppression of cytoplasmic pattern recognition receptor signaling pathway [inference]

symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity

biological process involved in symbiotic interaction [inference]

biological process involved in interaction with host [inference]

symbiont-mediated perturbation of host process [inference]

symbiont-mediated perturbation of host cellular process

symbiont-mediated transformation of host cell

symbiont-mediated perturbation of host cell cycle progression [inference]

symbiont-mediated perturbation of host cell cycle G1/S transition checkpoint

symbiont-mediated perturbation of host signal transduction pathway [inference]

symbiont-mediated suppression of host signal transduction pathway [inference]

symbiont-mediated suppression of host JAK-STAT cascade [inference]

symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT activity

symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT1 activity

symbiont-mediated suppression of host TRAF-mediated signal transduction

symbiont-mediated suppression of host pathogen-associated molecular pattern receptor signaling pathway [inference]

symbiont-mediated suppression of cytoplasmic pattern recognition receptor signaling pathway [inference]

symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity

symbiont-mediated suppression of host interferon-mediated signaling pathway [inference]

symbiont-mediated suppression of host type I interferon-mediated signaling pathway

symbiont-mediated perturbation of host autophagy [inference]

symbiont-mediated activation of host autophagy

symbiont-mediated perturbation of host defense response [inference]

symbiont-mediated perturbation of host immune response [inference]

symbiont-mediated perturbation of host innate immune response [inference]

symbiont-mediated suppression of host innate immune response [inference]

symbiont-mediated suppression of host pathogen-associated molecular pattern receptor signaling pathway [inference]

symbiont-mediated suppression of cytoplasmic pattern recognition receptor signaling pathway [inference]

symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity

symbiont-mediated suppression of host immune response [inference]

symbiont-mediated suppression of host innate immune response [inference]

symbiont-mediated suppression of host pathogen-associated molecular pattern receptor signaling pathway [inference]

symbiont-mediated suppression of cytoplasmic pattern recognition receptor signaling pathway [inference]

symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity

adhesion of symbiont to host [inference]

adhesion of symbiont to host cell [inference]

virion attachment to host cell [inference]

receptor-mediated virion attachment to host cell [inference]

symbiont entry into host [inference]

symbiont entry into host cell [inference]

endocytosis involved in viral entry into host cell [inference]

receptor-mediated endocytosis of virus by host cell [inference]

clathrin-dependent endocytosis of virus by host cell

translocation of molecules into host [inference]

translocation of peptides or proteins into host [inference]

translocation of peptides or proteins into host cell cytoplasm

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic ion transmembrane transport

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor-mediated endocytosis of virus by host cell [inference]

clathrin-dependent endocytosis of virus by host cell

clathrin-dependent endocytosis [inference]

clathrin-dependent endocytosis of virus by host cell

transmembrane transport [inference]

monoatomic ion transmembrane transport

import into cell [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor-mediated endocytosis of virus by host cell [inference]

clathrin-dependent endocytosis of virus by host cell

clathrin-dependent endocytosis [inference]

clathrin-dependent endocytosis of virus by host cell

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of protein secretion [inference]

negative regulation of protein secretion

negative regulation of protein transport [inference]

negative regulation of protein secretion

negative regulation of establishment of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion

negative regulation of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion

regulation of transport [inference]

regulation of secretion [inference]

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of protein secretion

regulation of secretion by cell [inference]

regulation of protein secretion [inference]

negative regulation of protein secretion

negative regulation of secretion by cell [inference]

negative regulation of protein secretion

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of protein secretion

negative regulation of protein transport [inference]

negative regulation of protein secretion

regulation of protein transport [inference]

regulation of protein secretion [inference]

negative regulation of protein secretion

negative regulation of protein transport [inference]

negative regulation of protein secretion

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of kinase activity [inference]

positive regulation of hexokinase activity

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of cytokinesis

positive regulation of cell division [inference]

positive regulation of cytokinesis

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of secretion by cell [inference]

negative regulation of protein secretion

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of protein secretion

negative regulation of protein transport [inference]

negative regulation of protein secretion

negative regulation of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion

negative regulation of establishment of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of kinase activity [inference]

positive regulation of hexokinase activity

regulation of phosphorus metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of kinase activity [inference]

positive regulation of hexokinase activity

regulation of phosphorylation [inference]

positive regulation of phosphorylation [inference]

positive regulation of kinase activity [inference]

positive regulation of hexokinase activity

regulation of kinase activity [inference]

positive regulation of kinase activity [inference]

positive regulation of hexokinase activity

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of kinase activity [inference]

positive regulation of hexokinase activity

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of cytokinesis

positive regulation of cell division [inference]

positive regulation of cytokinesis

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of secretion by cell [inference]

negative regulation of protein secretion

regulation of cell division [inference]

regulation of cytokinesis [inference]

positive regulation of cytokinesis

positive regulation of cell division [inference]

positive regulation of cytokinesis

regulation of cell cycle [inference]

regulation of cell cycle process [inference]

regulation of cytokinesis [inference]

positive regulation of cytokinesis

positive regulation of cell cycle process [inference]

positive regulation of cytokinesis

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of cytokinesis

regulation of secretion by cell [inference]

regulation of protein secretion [inference]

negative regulation of protein secretion

negative regulation of secretion by cell [inference]

negative regulation of protein secretion

regulation of molecular function [inference]

positive regulation of molecular function [inference]

positive regulation of catalytic activity [inference]

positive regulation of kinase activity [inference]

positive regulation of hexokinase activity

regulation of catalytic activity [inference]

positive regulation of catalytic activity [inference]

positive regulation of kinase activity [inference]

positive regulation of hexokinase activity

regulation of transferase activity [inference]

regulation of kinase activity [inference]

positive regulation of kinase activity [inference]

positive regulation of hexokinase activity

Displaying entries **1 - 5** of 23 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
viral nucleocapsid	IEA	GO_REF
viral envelope	IEA	GO_REF GO_REF
host cell plasma membrane	EXP	PMID PMID
host cell plasma membrane	IEA	GO_REF
endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	Reactome

GO Hierarchy

cellular component

protein-containing complex [inference]

ribonucleoprotein complex

virion component [inference]

viral nucleocapsid

viral membrane [inference]

viral envelope

virion membrane

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

bounding membrane of organelle [inference]

endoplasmic reticulum-Golgi intermediate compartment membrane

other organism part [inference]

host cellular component [inference]

host cell part [inference]

host cell membrane [inference]

host intracellular part [inference]

host intracellular organelle [inference]

host intracellular membrane-bounded organelle [inference]

host cell nucleus

host cell cytoplasm part [inference]

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
RNA binding	IDA	PMID
RNA binding	IEA	GO_REF GO_REF
RNA helicase activity	IEA	GO_REF
RNA-directed RNA polymerase activity	IDA	PMID
RNA-directed RNA polymerase activity	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

nucleotidyltransferase activity [inference]

RNA polymerase activity [inference]

5'-3' RNA polymerase activity [inference]

RNA-directed RNA polymerase activity

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity [inference]

cysteine-type peptidase activity [inference]

cysteine-type endopeptidase activity

serine-type peptidase activity [inference]

serine-type endopeptidase activity

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

ATP hydrolysis activity

serine hydrolase activity [inference]

serine-type peptidase activity [inference]

serine-type endopeptidase activity

isomerase activity [inference]

macromolecular conformation isomerase activity [inference]

nucleic acid conformation isomerase activity [inference]

helicase activity [inference]

RNA helicase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity [inference]

cysteine-type peptidase activity [inference]

cysteine-type endopeptidase activity

serine-type peptidase activity [inference]

serine-type endopeptidase activity

catalytic activity, acting on a nucleic acid [inference]

helicase activity [inference]

RNA helicase activity

catalytic activity, acting on RNA [inference]

RNA helicase activity

RNA polymerase activity [inference]

5'-3' RNA polymerase activity [inference]

RNA-directed RNA polymerase activity

structural molecule activity

transporter activity [inference]

transmembrane transporter activity [inference]

passive transmembrane transporter activity [inference]

channel activity

binding [inference]

nucleic acid binding [inference]

RNA binding

protein binding [inference]

signaling receptor binding [inference]

Toll-like receptor binding [inference]

Toll-like receptor 2 binding

enzyme binding [inference]

kinase binding

protein domain specific binding [inference]

SH3 domain binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

ATP-dependent activity [inference]

helicase activity [inference]

RNA helicase activity

ATP-dependent activity, acting on RNA [inference]

RNA helicase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSTNPKPQRKKPNVTPTVAHRTSSSRVAVRSLVEFTCCRAGALDWVCARRGRLPSGRNLEVDVSLSPRHVGPRAGPGLSPGTLGPSMAMRVAGGRDGSCLPVALGLAGAPQTPGVGRAIWVRSSIPLRAASPTSWGTYRSSAPLLEALPGPWRMASGFWKTA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying entries **1 - 10** of 18 in total

1

2

Next ›

Last »
Position	Description	PubMed ID	GlyTouCan ID	Source
110				GlyGen
196	N-linked (GlcNAc...) asparagine; by host	10211957		UniProt GlyGen
209	N-linked (GlcNAc...) asparagine; by host	10211957		UniProt GlyGen
234	N-linked (GlcNAc...) asparagine; by host	10211957		UniProt GlyGen
243				GlyGen
245				GlyGen
305	N-linked (GlcNAc...) asparagine; by host	10211957		UniProt GlyGen
417	N-linked (GlcNAc...) (high mannose) asparagine; by host	18187336	G80920RR G62765YT G31852PQ G41247ZX G02815KT G92050GC G28681TP	UniProt GlyGen
423	N-linked (GlcNAc...) (high mannose) asparagine; by host	18187336	G41247ZX G80475RE G02815KT G57317CE G92050GC G28681TP	UniProt GlyGen
430	N-linked (GlcNAc...) (high mannose) asparagine; by host	18187336 24288331	G25987BV G80475RE G20956ZV	UniProt GlyGen