GlyCosmos Portal

Annotation

Keyword: Calcium Cell adhesion Cell membrane Disulfide bond EGF-like domain Glycoprotein Lectin Metal-binding Reference proteome Repeat Signal Sushi Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
heterophilic cell-cell adhesion	IBA	GO_REF
calcium-dependent cell-cell adhesion	ISS	GO_REF
calcium-dependent cell-cell adhesion	ISO	GO_REF
response to ATP	ISO	GO_REF
response to cytokine	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell adhesion [inference]

cell-cell adhesion [inference]

heterophilic cell-cell adhesion

leukocyte cell-cell adhesion [inference]

leukocyte adhesion to vascular endothelial cell [inference]

leukocyte tethering or rolling

multicellular organismal process [inference]

system process [inference]

circulatory system process [inference]

vascular process in circulatory system [inference]

regulation of vascular permeability [inference]

positive regulation of vascular permeability

response to stimulus [inference]

response to stress [inference]

response to hyperoxia

response to abiotic stimulus [inference]

response to oxygen levels [inference]

response to increased oxygen levels [inference]

response to hyperoxia

response to chemical [inference]

response to lipid [inference]

response to fatty acid [inference]

response to organophosphorus [inference]

response to ATP

response to peptide [inference]

response to cytokine

cellular response to cytokine stimulus [inference]

cellular response to interleukin-8

response to interleukin-8 [inference]

cellular response to interleukin-8

response to nitrogen compound [inference]

response to purine-containing compound [inference]

response to ATP

response to oxygen-containing compound [inference]

response to ATP

response to fatty acid [inference]

response to alcohol [inference]

response to ethanol

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte migration [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of neutrophil mediated cytotoxicity

positive regulation of myeloid leukocyte mediated immunity [inference]

positive regulation of neutrophil mediated cytotoxicity

regulation of leukocyte migration [inference]

negative regulation of leukocyte migration [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of cellular extravasation [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

regulation of leukocyte tethering or rolling [inference]

negative regulation of leukocyte tethering or rolling

regulation of neutrophil migration [inference]

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of neutrophil mediated cytotoxicity

positive regulation of myeloid leukocyte mediated immunity [inference]

positive regulation of neutrophil mediated cytotoxicity

regulation of leukocyte mediated immunity [inference]

regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of neutrophil mediated cytotoxicity

regulation of neutrophil mediated cytotoxicity [inference]

positive regulation of neutrophil mediated cytotoxicity

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of neutrophil mediated cytotoxicity

positive regulation of myeloid leukocyte mediated immunity [inference]

positive regulation of neutrophil mediated cytotoxicity

regulation of myeloid leukocyte mediated immunity [inference]

positive regulation of myeloid leukocyte mediated immunity [inference]

positive regulation of neutrophil mediated cytotoxicity

regulation of neutrophil mediated cytotoxicity [inference]

positive regulation of neutrophil mediated cytotoxicity

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of leukocyte migration [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

regulation of chemotaxis [inference]

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

negative regulation of leukocyte migration [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of cellular extravasation [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

regulation of leukocyte tethering or rolling [inference]

negative regulation of leukocyte tethering or rolling

regulation of neutrophil migration [inference]

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

negative regulation of cell migration [inference]

negative regulation of leukocyte migration [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of leukocyte migration [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of neutrophil mediated cytotoxicity

positive regulation of myeloid leukocyte mediated immunity [inference]

positive regulation of neutrophil mediated cytotoxicity

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of cellular process [inference]

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of neutrophil mediated cytotoxicity

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte adhesion to vascular endothelial cell [inference]

positive regulation of leukocyte adhesion to arterial endothelial cell

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte migration [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of leukocyte migration [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte adhesion to vascular endothelial cell [inference]

negative regulation of leukocyte tethering or rolling

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of leukocyte migration [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of chemotaxis [inference]

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of cellular process [inference]

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte adhesion to vascular endothelial cell [inference]

negative regulation of leukocyte tethering or rolling

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte adhesion to vascular endothelial cell [inference]

negative regulation of leukocyte tethering or rolling

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte adhesion to vascular endothelial cell [inference]

positive regulation of leukocyte adhesion to arterial endothelial cell

regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte adhesion to vascular endothelial cell [inference]

negative regulation of leukocyte tethering or rolling

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte adhesion to vascular endothelial cell [inference]

positive regulation of leukocyte adhesion to arterial endothelial cell

regulation of leukocyte adhesion to vascular endothelial cell [inference]

regulation of leukocyte tethering or rolling [inference]

negative regulation of leukocyte tethering or rolling

negative regulation of leukocyte adhesion to vascular endothelial cell [inference]

negative regulation of leukocyte tethering or rolling

positive regulation of leukocyte adhesion to vascular endothelial cell [inference]

positive regulation of leukocyte adhesion to arterial endothelial cell

regulation of leukocyte adhesion to arterial endothelial cell [inference]

positive regulation of leukocyte adhesion to arterial endothelial cell

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte adhesion to vascular endothelial cell [inference]

positive regulation of leukocyte adhesion to arterial endothelial cell

regulation of cell killing [inference]

regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of neutrophil mediated cytotoxicity

regulation of neutrophil mediated cytotoxicity [inference]

positive regulation of neutrophil mediated cytotoxicity

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of neutrophil mediated cytotoxicity

regulation of programmed cell death [inference]

regulation of apoptotic process

positive regulation of cellular process [inference]

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of neutrophil mediated cytotoxicity

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte adhesion to vascular endothelial cell [inference]

positive regulation of leukocyte adhesion to arterial endothelial cell

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte adhesion to vascular endothelial cell [inference]

negative regulation of leukocyte tethering or rolling

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of leukocyte migration [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

negative regulation of leukocyte migration [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

regulation of cellular extravasation [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

regulation of leukocyte tethering or rolling [inference]

negative regulation of leukocyte tethering or rolling

regulation of neutrophil migration [inference]

regulation of neutrophil chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

negative regulation of cell migration [inference]

negative regulation of leukocyte migration [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of leukocyte migration [inference]

negative regulation of cellular extravasation [inference]

negative regulation of leukocyte tethering or rolling

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of granulocyte chemotaxis [inference]

positive regulation of neutrophil chemotaxis

positive regulation of neutrophil migration [inference]

positive regulation of neutrophil chemotaxis

regulation of biological quality [inference]

regulation of vascular permeability [inference]

positive regulation of vascular permeability

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	EXP	PMID
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell surface

membrane [inference]

plasma membrane

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
protease binding	ISO	GO_REF
calcium ion binding	ISS	GO_REF
calcium ion binding	ISO	GO_REF
sialic acid binding	IBA	GO_REF
cell adhesion molecule binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

protease binding

cell adhesion molecule binding

lipid binding [inference]

glycolipid binding

carbohydrate binding [inference]

oligosaccharide binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

sialic acid binding

cation binding [inference]

metal ion binding [inference]

calcium ion binding

organic acid binding [inference]

carboxylic acid binding [inference]

sialic acid binding

carbohydrate derivative binding [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVFPWRCQSAQRGSWSFLKLWIRTLLCCDLLPHHGTHCWTYHYSERSMNWENARKFCKHNYTDLVAIQNKREIEYLEKTLPKNPTYYWIGIRKIGKTWTWVGTNKTLTKEAENWGTGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPESCNRHGECVETINNNTCICDPGYYGPQCQYVIQCEPLKAPELGTMNCIHPLGDFSFQSQCAFNCSEGSELLGNAKTECGASGNWTYLEPICQVIQCMPLAAPDLGTMECSHPLANFSFTSACTFTCSEETDLIGERKTVCRSSGSWSSPSPICQKTKRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSQERMDDPY

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	Source
60	N-linked (GlcNAc...) asparagine	UniProt
104	N-linked (GlcNAc...) asparagine	UniProt
177	N-linked (GlcNAc...) asparagine	UniProt
226	N-linked (GlcNAc...) asparagine	UniProt
246	N-linked (GlcNAc...) asparagine	UniProt
278	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Cell surface interactions at the vascular wall	Rattus norvegicus
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell	Rattus norvegicus
Neutrophil degranulation	Rattus norvegicus

Disease

Displaying **all 2** entries
DO ID	Disease Name	Source
DOID:0060180	colitis	Alliance of Genome Resources
DOID:341	peripheral vascular disease	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements