GlyCosmos Portal

Submissions

Dipeptidase 1

Summary

UniProt ID: P31428
Gene Symbol: Dpep1 Mbd1 Rdp
Gene ID: 13479
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB

GPDB0003556

PubChem

P31428

SwissLipids

SLP:000001461

RaftProt

P31428

Re-Glyco

P31428

Annotation

Keyword: Cell membrane Cell projection Dipeptidase Disulfide bond GPI-anchor Lipid metabolism Metal-binding Metalloprotease Reference proteome Signal Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 21 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
proteolysis	IEA	GO_REF
leukotriene metabolic process	IDA	PMID
leukotriene metabolic process	IMP	PMID
glutathione catabolic process	IMP	PMID
inflammatory response	IMP	PMID

GO Hierarchy

biological process

immune system process [inference]

leukocyte migration [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

cellular process [inference]

metabolic process [inference]

modified amino acid metabolic process [inference]

glutathione metabolic process [inference]

glutathione catabolic process

modified amino acid catabolic process [inference]

glutathione catabolic process

sulfur compound metabolic process [inference]

sulfur amino acid metabolic process [inference]

homocysteine metabolic process

glutathione metabolic process [inference]

glutathione catabolic process

sulfur compound catabolic process [inference]

catabolic process [inference]

lipid catabolic process [inference]

fatty acid derivative catabolic process [inference]

icosanoid catabolic process [inference]

leukotriene D4 catabolic process

modified amino acid catabolic process [inference]

glutathione catabolic process

sulfur compound catabolic process [inference]

small molecule catabolic process [inference]

carboxylic acid catabolic process [inference]

leukotriene catabolic process [inference]

leukotriene D4 catabolic process

antibiotic metabolic process

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis

primary metabolic process [inference]

amino acid metabolic process [inference]

non-proteinogenic amino acid metabolic process [inference]

homocysteine metabolic process

lipid metabolic process [inference]

lipid catabolic process [inference]

fatty acid derivative catabolic process [inference]

icosanoid catabolic process [inference]

leukotriene D4 catabolic process

fatty acid derivative metabolic process [inference]

fatty acid derivative catabolic process [inference]

icosanoid catabolic process [inference]

leukotriene D4 catabolic process

protein metabolic process [inference]

proteolysis

small molecule metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

sulfur amino acid metabolic process [inference]

homocysteine metabolic process

icosanoid metabolic process [inference]

leukotriene metabolic process

leukotriene catabolic process [inference]

leukotriene D4 catabolic process

carboxylic acid catabolic process [inference]

leukotriene catabolic process [inference]

leukotriene D4 catabolic process

non-proteinogenic amino acid metabolic process [inference]

homocysteine metabolic process

small molecule catabolic process [inference]

carboxylic acid catabolic process [inference]

leukotriene catabolic process [inference]

leukotriene D4 catabolic process

cell motility [inference]

cell migration [inference]

leukocyte migration [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to metal ion [inference]

cellular response to calcium ion

cellular response to nitrogen compound [inference]

cellular response to reactive nitrogen species [inference]

cellular response to nitric oxide

cellular response to oxygen-containing compound [inference]

cellular response to nitric oxide

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response

response to chemical [inference]

response to metal ion [inference]

response to calcium ion [inference]

cellular response to calcium ion

cellular response to metal ion [inference]

cellular response to calcium ion

cellular response to chemical stimulus [inference]

cellular response to metal ion [inference]

cellular response to calcium ion

cellular response to nitrogen compound [inference]

cellular response to reactive nitrogen species [inference]

cellular response to nitric oxide

cellular response to oxygen-containing compound [inference]

cellular response to nitric oxide

response to nitrogen compound [inference]

response to nitric oxide [inference]

cellular response to nitric oxide

cellular response to nitrogen compound [inference]

cellular response to reactive nitrogen species [inference]

cellular response to nitric oxide

response to oxygen-containing compound [inference]

response to nitric oxide [inference]

cellular response to nitric oxide

cellular response to oxygen-containing compound [inference]

cellular response to nitric oxide

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to metal ion [inference]

cellular response to calcium ion

cellular response to nitrogen compound [inference]

cellular response to reactive nitrogen species [inference]

cellular response to nitric oxide

cellular response to oxygen-containing compound [inference]

cellular response to nitric oxide

biological regulation [inference]

regulation of biological process [inference]

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of biological process [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cellular process [inference]

negative regulation of cellular process [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
nucleoplasm	ISO	GO_REF
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

nucleoplasm

membrane [inference]

plasma membrane

plasma membrane region [inference]

apical plasma membrane

cell projection membrane [inference]

microvillus membrane

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
zinc ion binding	ISS	GO_REF
zinc ion binding	ISO	GO_REF
zinc ion binding	IEA	GO_REF
beta-lactamase activity	ISO	GO_REF
beta-lactamase activity	IDA	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

metallopeptidase activity [inference]

metalloexopeptidase activity [inference]

metallodipeptidase activity

exopeptidase activity [inference]

metalloexopeptidase activity [inference]

metallodipeptidase activity

dipeptidase activity

metallodipeptidase activity

hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds [inference]

hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides [inference]

beta-lactamase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

metallopeptidase activity [inference]

metalloexopeptidase activity [inference]

metallodipeptidase activity

exopeptidase activity [inference]

metalloexopeptidase activity [inference]

metallodipeptidase activity

dipeptidase activity

metallodipeptidase activity

binding [inference]

lipid binding [inference]

phospholipid binding [inference]

GPI anchor binding

glycolipid binding [inference]

GPI anchor binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

modified amino acid binding

carbohydrate derivative binding [inference]

glycolipid binding [inference]

GPI anchor binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVIIWWFWSLLAICASDSFRDQAVAIMRTTPVIDGHNDLPWQLLNLFNNQLLRPDADLNKLAQTHTNIPKLKAGFVGGQFWSAYMPCDTQNKDAVKRILEQMDVIHRMCQLYPETFMCVTNSSDILQAFRRGKVASLIGVEGGHLIDSSLGVLRTLYHLGMRYLTLTHNCNTPWADNWLVDRGDDEAESHGLSPFGKRLLNEMNRLGVMIDLSHVSVATMKDALQISRAPVIFSHSSAYSLCPHRRNVPDDVLQLVKNTSSLVMVNFFSNFVSCSDSATLPQVADHLDHIKKVAGAGAVGLGGDYDGVTMLPVGLEDVSKYPDLIAELLRRNWTETEVRGLLADNLIRVFSEVELVSNNMQSPEEVPITLKELDGSCRTYYGYSQAHSIHLQTGALVASLASLLFRLHLL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	GlyTouCan ID	Source
121	N-linked (GlcNAc...) asparagine		GlycoProtDB UniProt
258	N-linked (GlcNAc...) asparagine		GlycoProtDB UniProt
332	N-linked (GlcNAc...) asparagine	G11917LX G46312WW G40024DP G51356MD G21952EN G54678CA G57615MD G15450FJ G79421NO G44231RW G57471MV G35510GA G28868TO G20425TQ G44437FL G04062KZ G00490MQ G98147MD G02281EI G13749ZZ G27336AY G22267GY	GlycoProtDB UniProt