GlyCosmos Portal

Submissions

Fibroblast growth factor 8

Summary

UniProt ID

P37237

Gene Symbol

Aigf
Fgf8

Gene ID

14179

Organism

Mus musculus (house mouse)

External Links

PubChem: P37237
Re-Glyco: P37237

Annotation

Keyword: Alternative splicing Developmental protein Differentiation Direct protein sequencing Glycoprotein Growth factor Mitogen Pyrrolidone carboxylic acid Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 98 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
MAPK cascade	IMP	PMID
branching involved in blood vessel morphogenesis	IGI	PMID
metanephros development	IEA	GO_REF
branching involved in ureteric bud morphogenesis	IMP	PMID
organ induction	IGI	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

fibroblast growth factor receptor signaling pathway

signal transduction involved in regulation of gene expression

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

MAPK cascade

cell population proliferation [inference]

neural precursor cell proliferation [inference]

cell proliferation in forebrain

cellular developmental process [inference]

cell differentiation [inference]

neurogenesis

generation of neurons

neuron differentiation [inference]

central nervous system neuron differentiation [inference]

forebrain neuron differentiation [inference]

thyroid-stimulating hormone-secreting cell differentiation

neuroendocrine cell differentiation [inference]

thyroid-stimulating hormone-secreting cell differentiation

dopaminergic neuron differentiation

epithelial cell differentiation [inference]

columnar/cuboidal epithelial cell differentiation [inference]

glandular epithelial cell differentiation [inference]

thyroid-stimulating hormone-secreting cell differentiation

neuroepithelial cell differentiation

neuroendocrine cell differentiation [inference]

thyroid-stimulating hormone-secreting cell differentiation

mesenchymal cell differentiation [inference]

epithelial to mesenchymal transition [inference]

cardiac epithelial to mesenchymal transition [inference]

epithelial to mesenchymal transition involved in endocardial cushion formation

corticotropin hormone secreting cell differentiation

cell fate commitment

cell development [inference]

neuron development [inference]

central nervous system neuron development

forebrain neuron development

cell motility [inference]

cell migration [inference]

ameboidal-type cell migration [inference]

mesodermal cell migration

cell migration involved in gastrulation [inference]

cell migration involved in mesendoderm migration

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection guidance [inference]

axon guidance [inference]

reproductive process [inference]

developmental process involved in reproduction [inference]

reproductive structure development [inference]

gonad development

genitalia development [inference]

male genitalia development

multicellular organismal process [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in salivary gland morphogenesis

multicellular organism development [inference]

embryo development [inference]

embryo development ending in birth or egg hatching

pattern specification process [inference]

regionalization [inference]

dorsal/ventral pattern formation

forebrain dorsal/ventral pattern formation

specification of symmetry [inference]

determination of bilateral symmetry [inference]

determination of left/right symmetry

tissue remodeling [inference]

blood vessel remodeling

developmental process [inference]

developmental process involved in reproduction [inference]

reproductive structure development [inference]

gonad development

genitalia development [inference]

male genitalia development

anatomical structure morphogenesis [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in salivary gland morphogenesis

outflow tract morphogenesis

animal organ morphogenesis [inference]

appendage morphogenesis [inference]

limb morphogenesis

embryonic limb morphogenesis [inference]

embryonic hindlimb morphogenesis

hindlimb morphogenesis [inference]

embryonic hindlimb morphogenesis

embryonic appendage morphogenesis [inference]

embryonic limb morphogenesis [inference]

embryonic hindlimb morphogenesis

tube morphogenesis [inference]

blood vessel morphogenesis [inference]

artery morphogenesis [inference]

aorta morphogenesis

branching morphogenesis of an epithelial tube [inference]

epithelial tube morphogenesis [inference]

embryonic heart tube morphogenesis [inference]

heart looping

embryonic morphogenesis [inference]

embryonic heart tube morphogenesis [inference]

heart looping

morphogenesis of embryonic epithelium [inference]

neural plate morphogenesis

embryonic appendage morphogenesis [inference]

embryonic limb morphogenesis [inference]

embryonic hindlimb morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of embryonic epithelium [inference]

neural plate morphogenesis

epithelial tube morphogenesis [inference]

embryonic heart tube morphogenesis [inference]

heart looping

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in salivary gland morphogenesis

forebrain morphogenesis

cardiac septum morphogenesis [inference]

outflow tract septum morphogenesis

developmental induction [inference]

organ induction

anatomical structure formation involved in morphogenesis [inference]

tube formation [inference]

epithelial tube formation [inference]

otic vesicle formation

anatomical structure development [inference]

multicellular organism development [inference]

embryo development [inference]

embryo development ending in birth or egg hatching

tissue development [inference]

epithelium development [inference]

embryonic heart tube development

tube development [inference]

embryonic heart tube development

cell development [inference]

neuron development [inference]

central nervous system neuron development

forebrain neuron development

animal organ development [inference]

kidney development

metanephros development

gland development [inference]

thyroid gland development

genitalia development [inference]

male genitalia development

bone development

reproductive structure development [inference]

gonad development

genitalia development [inference]

male genitalia development

system development [inference]

pharyngeal system development

reproductive system development [inference]

male genitalia development

cellular developmental process [inference]

cell differentiation [inference]

neurogenesis

generation of neurons

neuron differentiation [inference]

central nervous system neuron differentiation [inference]

forebrain neuron differentiation [inference]

thyroid-stimulating hormone-secreting cell differentiation

neuroendocrine cell differentiation [inference]

thyroid-stimulating hormone-secreting cell differentiation

dopaminergic neuron differentiation

epithelial cell differentiation [inference]

columnar/cuboidal epithelial cell differentiation [inference]

glandular epithelial cell differentiation [inference]

thyroid-stimulating hormone-secreting cell differentiation

neuroepithelial cell differentiation

neuroendocrine cell differentiation [inference]

thyroid-stimulating hormone-secreting cell differentiation

mesenchymal cell differentiation [inference]

epithelial to mesenchymal transition [inference]

cardiac epithelial to mesenchymal transition [inference]

epithelial to mesenchymal transition involved in endocardial cushion formation

corticotropin hormone secreting cell differentiation

cell fate commitment

cell development [inference]

neuron development [inference]

central nervous system neuron development

forebrain neuron development

response to stimulus [inference]

response to stress [inference]

response to oxidative stress

response to chemical [inference]

response to xenobiotic stimulus

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

regulation of growth [inference]

positive regulation of growth [inference]

positive regulation of developmental growth [inference]

positive regulation of organ growth

regulation of developmental growth [inference]

regulation of organ growth [inference]

positive regulation of organ growth

positive regulation of developmental growth [inference]

positive regulation of organ growth

regulation of locomotion [inference]

regulation of cell motility [inference]

regulation of cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of growth [inference]

positive regulation of developmental growth [inference]

positive regulation of organ growth

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of cell division

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of developmental process [inference]

positive regulation of developmental growth [inference]

positive regulation of organ growth

positive regulation of animal organ morphogenesis [inference]

organ induction

positive regulation of multicellular organismal process [inference]

positive regulation of organ growth

positive regulation of animal organ morphogenesis [inference]

organ induction

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of neuron apoptotic process

negative regulation of developmental process [inference]

negative regulation of muscle organ development [inference]

negative regulation of striated muscle tissue development [inference]

negative regulation of cardiac muscle tissue development

negative regulation of muscle tissue development [inference]

negative regulation of striated muscle tissue development [inference]

negative regulation of cardiac muscle tissue development

negative regulation of multicellular organismal process [inference]

negative regulation of muscle organ development [inference]

negative regulation of striated muscle tissue development [inference]

negative regulation of cardiac muscle tissue development

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of animal organ morphogenesis [inference]

regulation of animal organ formation [inference]

organ induction

regulation of odontogenesis [inference]

regulation of odontogenesis of dentin-containing tooth

positive regulation of animal organ morphogenesis [inference]

organ induction

regulation of muscle organ development [inference]

regulation of striated muscle tissue development [inference]

negative regulation of striated muscle tissue development [inference]

negative regulation of cardiac muscle tissue development

regulation of cardiac muscle tissue development [inference]

negative regulation of cardiac muscle tissue development

negative regulation of muscle organ development [inference]

negative regulation of striated muscle tissue development [inference]

negative regulation of cardiac muscle tissue development

regulation of developmental growth [inference]

regulation of organ growth [inference]

positive regulation of organ growth

positive regulation of developmental growth [inference]

positive regulation of organ growth

negative regulation of developmental process [inference]

negative regulation of muscle organ development [inference]

negative regulation of striated muscle tissue development [inference]

negative regulation of cardiac muscle tissue development

negative regulation of muscle tissue development [inference]

negative regulation of striated muscle tissue development [inference]

negative regulation of cardiac muscle tissue development

positive regulation of developmental process [inference]

positive regulation of developmental growth [inference]

positive regulation of organ growth

positive regulation of animal organ morphogenesis [inference]

organ induction

regulation of muscle tissue development [inference]

regulation of striated muscle tissue development [inference]

negative regulation of striated muscle tissue development [inference]

negative regulation of cardiac muscle tissue development

regulation of cardiac muscle tissue development [inference]

negative regulation of cardiac muscle tissue development

negative regulation of muscle tissue development [inference]

negative regulation of striated muscle tissue development [inference]

negative regulation of cardiac muscle tissue development

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

fibroblast growth factor receptor signaling pathway

signal transduction involved in regulation of gene expression

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

MAPK cascade

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of neuron apoptotic process

regulation of neuron apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of neuron apoptotic process

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of cell division

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of neuron apoptotic process

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

regulation of nuclear division [inference]

regulation of mitotic nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

regulation of cell division [inference]

positive regulation of cell division

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

regulation of mitotic nuclear division [inference]

positive regulation of mitotic nuclear division

regulation of cell cycle process [inference]

regulation of mitotic nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

regulation of cell motility [inference]

regulation of cell migration

regulation of multicellular organismal process [inference]

regulation of organ growth [inference]

positive regulation of organ growth

positive regulation of multicellular organismal process [inference]

positive regulation of organ growth

positive regulation of animal organ morphogenesis [inference]

organ induction

negative regulation of multicellular organismal process [inference]

negative regulation of muscle organ development [inference]

negative regulation of striated muscle tissue development [inference]

negative regulation of cardiac muscle tissue development

Displaying **all 4** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
cytoplasm	IBA	GO_REF
external side of plasma membrane	ISO	GO_REF
external side of plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
type 1 fibroblast growth factor receptor binding	ISO	GO_REF
type 1 fibroblast growth factor receptor binding	IBA	GO_REF
type 2 fibroblast growth factor receptor binding	ISO	GO_REF
type 2 fibroblast growth factor receptor binding	IBA	GO_REF
growth factor activity	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

growth factor receptor binding [inference]

fibroblast growth factor receptor binding [inference]

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGSPRSALSCLLLHLLVLCLQAQVRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQRHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
60	N-linked (GlcNAc...) asparagine			UniProt
190	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 31 in total

1

2

3

4

Next ›

Last »
Pathway Name	Organism
Downstream signaling of activated FGFR1	Mus musculus
FGFR1c ligand binding and activation	Mus musculus
FGFR2c ligand binding and activation	Mus musculus
FGFR3b ligand binding and activation	Mus musculus
FGFR3c ligand binding and activation	Mus musculus
FGFR4 ligand binding and activation	Mus musculus
FGFRL1 modulation of FGFR1 signaling	Mus musculus
FRS-mediated FGFR1 signaling	Mus musculus
FRS-mediated FGFR2 signaling	Mus musculus
FRS-mediated FGFR3 signaling	Mus musculus

Disease

Displaying **all 2** entries
DO ID	Disease Name	Source
DOID:11198	DiGeorge syndrome	Alliance of Genome Resources
DOID:6419	tetralogy of Fallot	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements