GlyCosmos Portal

Submissions

Annexin A5

Summary

UniProt ID: P48036
Gene Symbol: Anx5 Anxa5
Gene ID: 11747
Organism: Mus musculus (house mouse)

External Links

PubChem: P48036
The O-GlcNAc Database: P48036
RaftProt: P48036
Re-Glyco: P48036

Annotation

Keyword: Acetylation Annexin Blood coagulation Calcium/phospholipid-binding Direct protein sequencing Isopeptide bond Phosphoprotein Reference proteome Repeat S-nitrosylation Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
blood coagulation
negative regulation of blood coagulation	ISO	GO_REF
positive regulation of apoptotic process	ISO	GO_REF
response to calcium ion	ISO	GO_REF
cellular response to gonadotropin-releasing hormone	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

multicellular organismal process [inference]

coagulation [inference]

blood coagulation

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

response to peptide hormone [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

response to gonadotropin-releasing hormone [inference]

cellular response to gonadotropin-releasing hormone

cellular response to endogenous stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

response to chemical [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

response to peptide hormone [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

response to gonadotropin-releasing hormone [inference]

cellular response to gonadotropin-releasing hormone

response to metal ion [inference]

response to calcium ion

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

response to nitrogen compound [inference]

response to peptide hormone [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

response to gonadotropin-releasing hormone [inference]

cellular response to gonadotropin-releasing hormone

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

response to oxygen-containing compound [inference]

response to peptide hormone [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

response to gonadotropin-releasing hormone [inference]

cellular response to gonadotropin-releasing hormone

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to gonadotropin-releasing hormone

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

negative regulation of signaling [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of peptide hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

negative regulation of establishment of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

negative regulation of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

regulation of transport [inference]

regulation of secretion [inference]

regulation of peptide secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of peptide hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

negative regulation of secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of peptide hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

regulation of protein transport [inference]

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

regulation of peptide transport [inference]

regulation of peptide secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of peptide hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of locomotion [inference]

regulation of cell motility [inference]

regulation of cilium-dependent cell motility [inference]

regulation of cilium movement involved in cell motility [inference]

regulation of flagellated sperm motility

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation [inference]

negative regulation of blood coagulation

negative regulation of hemostasis [inference]

negative regulation of blood coagulation

negative regulation of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

negative regulation of establishment of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

regulation of response to stress [inference]

regulation of response to wounding [inference]

regulation of wound healing [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation

negative regulation of wound healing [inference]

negative regulation of blood coagulation

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

regulation of cellular process [inference]

regulation of cell communication [inference]

negative regulation of cell communication [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of peptide hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of microtubule-based process [inference]

regulation of microtubule-based movement [inference]

regulation of cilium movement [inference]

regulation of cilium movement involved in cell motility [inference]

regulation of flagellated sperm motility

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of cellular process [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of peptide hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

negative regulation of protein secretion [inference]

negative regulation of prolactin secretion

regulation of cell motility [inference]

regulation of cilium-dependent cell motility [inference]

regulation of cilium movement involved in cell motility [inference]

regulation of flagellated sperm motility

regulation of multicellular organismal process [inference]

regulation of coagulation [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation

negative regulation of coagulation [inference]

negative regulation of blood coagulation

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation [inference]

negative regulation of blood coagulation

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation

negative regulation of hemostasis [inference]

negative regulation of blood coagulation

regulation of reproductive process [inference]

regulation of flagellated sperm motility

regulation of biological quality [inference]

regulation of hormone levels [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of peptide hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of prolactin secretion

regulation of body fluid levels [inference]

hemostasis [inference]

blood coagulation

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation

negative regulation of hemostasis [inference]

negative regulation of blood coagulation

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
cytoplasm
synaptic vesicle	ISO	GO_REF
external side of plasma membrane	IDA	PMID PMID PMID PMID
vesicle membrane	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

membrane [inference]

plasma membrane [inference]

sarcolemma

organelle membrane [inference]

vesicle membrane

cytoplasmic vesicle membrane [inference]

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

bounding membrane of organelle [inference]

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

Z disc

cell junction [inference]

anchoring junction [inference]

cell-cell junction [inference]

cell-cell contact zone [inference]

intercalated disc

external encapsulating structure [inference]

extracellular matrix

cell projection

plasma membrane bounded cell projection [inference]

neuron projection [inference]

dendrite

perikaryon

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

cell body [inference]

neuronal cell body

neuron projection terminus [inference]

axon terminus

blood microparticle [inference]

endothelial microparticle

side of membrane [inference]

external side of plasma membrane

presynapse [inference]

axon terminus

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
phosphatidylserine binding	IDA	PMID
phosphatidylserine binding	IBA	GO_REF
P-type calcium transporter activity	ISO	GO_REF
calcium ion binding	IEA	GO_REF
calcium-dependent phospholipid binding	ISO	GO_REF GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type calcium transporter activity

metal ion transmembrane transporter activity [inference]

calcium ion transmembrane transporter activity [inference]

P-type calcium transporter activity

active monoatomic ion transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type calcium transporter activity

active transmembrane transporter activity [inference]

primary active transmembrane transporter activity [inference]

active monoatomic ion transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type calcium transporter activity

ATPase-coupled transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type calcium transporter activity

P-type transmembrane transporter activity [inference]

P-type ion transporter activity [inference]

P-type calcium transporter activity

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

receptor tyrosine kinase binding

enzyme binding [inference]

kinase binding [inference]

protein kinase binding [inference]

protein tyrosine kinase binding [inference]

receptor tyrosine kinase binding

identical protein binding

lipid binding [inference]

phospholipid binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

phosphatidylserine binding

cation binding [inference]

metal ion binding [inference]

calcium ion binding

hormone binding [inference]

peptide hormone binding

modified amino acid binding [inference]

phosphatidylserine binding

ATP-dependent activity [inference]

ATPase-coupled transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type calcium transporter activity

P-type transmembrane transporter activity [inference]

P-type ion transporter activity [inference]

P-type calcium transporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MATRGTVTDFPGFDGRADAEVLRKAMKGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites