GlyCosmos Portal

Submissions

Bone morphogenetic protein 5

Summary

UniProt ID: P49003
Gene Symbol: Bmp5 Bmp-5
Gene ID: 12160
Organism: Mus musculus (house mouse)

External Links

PubChem: P49003
The Human Metabolome Database: HMDBP14527
Re-Glyco: P49003

Annotation

Keyword: Alternative splicing Chondrogenesis Cleavage on pair of basic residues Cytokine Developmental protein Differentiation Disulfide bond Glycoprotein Growth factor Osteogenesis Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 43 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
skeletal system development	IMP	PMID
ossification
endocardial cushion formation	IGI	PMID
type B pancreatic cell development	ISO	GO_REF
type B pancreatic cell development	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell adhesion [inference]

cell-cell adhesion [inference]

chorio-allantoic fusion

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

cellular developmental process [inference]

cell development [inference]

epithelial cell development [inference]

type B pancreatic cell development

reproductive process [inference]

developmental process involved in reproduction [inference]

reproductive structure development [inference]

genitalia development [inference]

male genitalia development

multicellular organismal process [inference]

developmental process [inference]

developmental process involved in reproduction [inference]

reproductive structure development [inference]

genitalia development [inference]

male genitalia development

anatomical structure morphogenesis [inference]

embryonic morphogenesis [inference]

pericardium morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of an epithelial sheet [inference]

pericardium morphogenesis

cardiac septum morphogenesis

trabecula morphogenesis [inference]

heart trabecula morphogenesis

anatomical structure formation involved in morphogenesis [inference]

anatomical structure development [inference]

tissue development [inference]

muscle tissue development [inference]

striated muscle tissue development [inference]

cardiac muscle tissue development

hindbrain development

cell development [inference]

epithelial cell development [inference]

type B pancreatic cell development

animal organ development [inference]

sensory organ development [inference]

ear development

heart development

genitalia development [inference]

male genitalia development

cartilage development

reproductive structure development [inference]

genitalia development [inference]

male genitalia development

system development [inference]

reproductive system development [inference]

male genitalia development

head development [inference]

anterior head development

extraembryonic membrane development [inference]

allantois development

cellular developmental process [inference]

cell development [inference]

epithelial cell development [inference]

type B pancreatic cell development

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

negative regulation of signal transduction [inference]

negative regulation of insulin-like growth factor receptor signaling pathway

regulation of insulin-like growth factor receptor signaling pathway [inference]

negative regulation of insulin-like growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of SMAD protein signal transduction

regulation of intracellular signal transduction [inference]

regulation of SMAD protein signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin-like growth factor receptor signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of epithelial cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development [inference]

positive regulation of dendrite development

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of developmental process [inference]

positive regulation of dendrite development

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin-like growth factor receptor signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of alcohol biosynthetic process [inference]

negative regulation of hormone metabolic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of lipid metabolic process [inference]

negative regulation of steroid metabolic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of small molecule metabolic process [inference]

negative regulation of alcohol biosynthetic process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin-like growth factor receptor signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin-like growth factor receptor signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

negative regulation of signal transduction [inference]

negative regulation of insulin-like growth factor receptor signaling pathway

regulation of insulin-like growth factor receptor signaling pathway [inference]

negative regulation of insulin-like growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of SMAD protein signal transduction

regulation of intracellular signal transduction [inference]

regulation of SMAD protein signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin-like growth factor receptor signaling pathway

regulation of developmental process [inference]

regulation of dendrite development [inference]

positive regulation of dendrite development

positive regulation of developmental process [inference]

positive regulation of dendrite development

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

negative regulation of signal transduction [inference]

negative regulation of insulin-like growth factor receptor signaling pathway

regulation of insulin-like growth factor receptor signaling pathway [inference]

negative regulation of insulin-like growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of SMAD protein signal transduction

regulation of intracellular signal transduction [inference]

regulation of SMAD protein signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin-like growth factor receptor signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of alcohol biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of ketone biosynthetic process [inference]

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

regulation of cortisol biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of hormone biosynthetic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

regulation of steroid hormone biosynthetic process [inference]

regulation of glucocorticoid biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of cortisol biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

regulation of lipid biosynthetic process [inference]

regulation of steroid biosynthetic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

regulation of steroid hormone biosynthetic process [inference]

regulation of glucocorticoid biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of cortisol biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

regulation of alcohol biosynthetic process [inference]

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

negative regulation of alcohol biosynthetic process [inference]

regulation of cortisol biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of alcohol biosynthetic process [inference]

negative regulation of hormone metabolic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of lipid metabolic process [inference]

negative regulation of steroid metabolic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of small molecule metabolic process [inference]

negative regulation of alcohol biosynthetic process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of ketone metabolic process [inference]

regulation of ketone biosynthetic process [inference]

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

regulation of cortisol biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of aldosterone metabolic process [inference]

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

regulation of hormone metabolic process [inference]

regulation of glucocorticoid metabolic process [inference]

regulation of glucocorticoid biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of cortisol biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of aldosterone metabolic process [inference]

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

negative regulation of hormone metabolic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

regulation of hormone biosynthetic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

regulation of steroid hormone biosynthetic process [inference]

regulation of glucocorticoid biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of cortisol biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of small molecule metabolic process [inference]

regulation of ketone biosynthetic process [inference]

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

regulation of cortisol biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of aldosterone metabolic process [inference]

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

negative regulation of small molecule metabolic process [inference]

negative regulation of alcohol biosynthetic process [inference]

regulation of alcohol biosynthetic process [inference]

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

negative regulation of alcohol biosynthetic process [inference]

regulation of cortisol biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of primary metabolic process [inference]

regulation of lipid metabolic process [inference]

regulation of steroid metabolic process [inference]

regulation of glucocorticoid metabolic process [inference]

regulation of glucocorticoid biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of cortisol biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of aldosterone metabolic process [inference]

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

negative regulation of steroid metabolic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

regulation of steroid biosynthetic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

regulation of steroid hormone biosynthetic process [inference]

regulation of glucocorticoid biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of cortisol biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of lipid metabolic process [inference]

negative regulation of steroid metabolic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

regulation of lipid biosynthetic process [inference]

regulation of steroid biosynthetic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

regulation of steroid hormone biosynthetic process [inference]

regulation of glucocorticoid biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of cortisol biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of epithelial cell proliferation

negative regulation of cell population proliferation

regulation of epithelial cell proliferation [inference]

positive regulation of epithelial cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of epithelial cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development [inference]

positive regulation of dendrite development

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of alcohol biosynthetic process [inference]

negative regulation of hormone metabolic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of lipid metabolic process [inference]

negative regulation of steroid metabolic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of lipid biosynthetic process [inference]

negative regulation of steroid biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

negative regulation of small molecule metabolic process [inference]

negative regulation of alcohol biosynthetic process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin-like growth factor receptor signaling pathway

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development [inference]

positive regulation of dendrite development

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

positive regulation of neuron projection development [inference]

positive regulation of dendrite development

regulation of dendrite development [inference]

positive regulation of dendrite development

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development [inference]

positive regulation of dendrite development

regulation of biological quality [inference]

regulation of hormone levels [inference]

regulation of hormone metabolic process [inference]

regulation of glucocorticoid metabolic process [inference]

regulation of glucocorticoid biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of cortisol biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of aldosterone metabolic process [inference]

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

negative regulation of hormone metabolic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

regulation of hormone biosynthetic process [inference]

negative regulation of hormone biosynthetic process [inference]

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

regulation of steroid hormone biosynthetic process [inference]

regulation of glucocorticoid biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of cortisol biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

regulation of aldosterone biosynthetic process [inference]

negative regulation of aldosterone biosynthetic process

negative regulation of steroid hormone biosynthetic process [inference]

negative regulation of glucocorticoid biosynthetic process [inference]

negative regulation of cortisol biosynthetic process

negative regulation of aldosterone biosynthetic process

Displaying **all 3** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
vesicle	ISO	GO_REF
vesicle	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle

Displaying **all 4** entries
GO Term	Evidence Code	Reference
cytokine activity	IBA	GO_REF
growth factor activity	IEA	GO_REF
BMP receptor binding	ISO	PMID
BMP receptor binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

receptor serine/threonine kinase binding [inference]

transmembrane receptor protein serine/threonine kinase binding [inference]

BMP receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MHWTVFLLRGIVGFLWSGWVQVGYAKGGLGDNHVHSSFIYRRLRNHERREIQREILSILGLPHRPRPFSPGKQASSAPLFMLDLYNAMASEDNPEEYLVRVSLAGEAKETRKGYPASPNGYAHRLHLPPRTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEFRFDLTQIPHGEAVTAAEFRIYKDKGNHRFENETIKISIYQIIKEYTNRDADLFLLDTRKTQALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRHGPQSKQPFMVAFFKASEVLLRSVRAASKRKNQNRNKSNSHQDPSRMPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
209	N-linked (GlcNAc...) asparagine	UniProt
325	N-linked (GlcNAc...) asparagine	UniProt
343	N-linked (GlcNAc...) asparagine	UniProt
393	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0060306	Meier-Gorlin syndrome	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements