GlyCosmos Portal

Submissions

Aldo-keto reductase family 1 member A1

Summary

UniProt ID: P51635
Gene Symbol: Akr1a1 Alr
Gene ID: 78959
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: P51635
Re-Glyco: P51635

Annotation

Keyword: Acetylation Cell membrane Cytoplasm Direct protein sequencing Glycation Lipid metabolism NADP Oxidoreductase Phosphoprotein Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
lipid metabolic process
D-glucuronate catabolic process to D-xylulose 5-phosphate
L-ascorbic acid biosynthetic process	ISO	GO_REF
L-ascorbic acid biosynthetic process	IMP	PMID
L-ascorbic acid biosynthetic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

aldehyde metabolic process [inference]

aldehyde catabolic process

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

D-xylulose 5-phosphate metabolic process [inference]

D-glucuronate catabolic process to D-xylulose 5-phosphate

organophosphate metabolic process [inference]

D-xylulose 5-phosphate metabolic process [inference]

D-glucuronate catabolic process to D-xylulose 5-phosphate

catabolic process [inference]

small molecule catabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

glucuronate catabolic process [inference]

D-glucuronate catabolic process

D-glucuronate catabolic process to D-xylulose 5-phosphate

aldehyde catabolic process

biosynthetic process [inference]

carbohydrate biosynthetic process [inference]

monosaccharide biosynthetic process [inference]

L-ascorbic acid biosynthetic process

small molecule biosynthetic process [inference]

vitamin biosynthetic process [inference]

water-soluble vitamin biosynthetic process [inference]

L-ascorbic acid biosynthetic process

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

L-ascorbic acid biosynthetic process

monosaccharide biosynthetic process [inference]

L-ascorbic acid biosynthetic process

lactone biosynthetic process [inference]

L-ascorbic acid biosynthetic process

secondary metabolic process [inference]

polyketide metabolic process [inference]

ketone metabolic process [inference]

primary metabolic process [inference]

carbohydrate metabolic process [inference]

monosaccharide metabolic process [inference]

L-ascorbic acid metabolic process [inference]

L-ascorbic acid biosynthetic process

monosaccharide biosynthetic process [inference]

L-ascorbic acid biosynthetic process

carbohydrate biosynthetic process [inference]

monosaccharide biosynthetic process [inference]

L-ascorbic acid biosynthetic process

lipid metabolic process

small molecule metabolic process [inference]

monosaccharide metabolic process [inference]

L-ascorbic acid metabolic process [inference]

L-ascorbic acid biosynthetic process

monosaccharide biosynthetic process [inference]

L-ascorbic acid biosynthetic process

alcohol metabolic process [inference]

primary alcohol metabolic process [inference]

doxorubicin metabolic process

tertiary alcohol metabolic process [inference]

doxorubicin metabolic process

organic acid metabolic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

L-ascorbic acid biosynthetic process

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

glucuronate catabolic process [inference]

D-glucuronate catabolic process

D-glucuronate catabolic process to D-xylulose 5-phosphate

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

L-ascorbic acid metabolic process [inference]

L-ascorbic acid biosynthetic process

monocarboxylic acid metabolic process [inference]

glucuronate metabolic process [inference]

glucuronate catabolic process [inference]

D-glucuronate catabolic process

D-glucuronate catabolic process to D-xylulose 5-phosphate

monocarboxylic acid catabolic process [inference]

glucuronate catabolic process [inference]

D-glucuronate catabolic process

D-glucuronate catabolic process to D-xylulose 5-phosphate

carboxylic acid biosynthetic process [inference]

L-ascorbic acid biosynthetic process

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

glucuronate catabolic process [inference]

D-glucuronate catabolic process

D-glucuronate catabolic process to D-xylulose 5-phosphate

vitamin metabolic process [inference]

vitamin biosynthetic process [inference]

water-soluble vitamin biosynthetic process [inference]

L-ascorbic acid biosynthetic process

small molecule catabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

glucuronate catabolic process [inference]

D-glucuronate catabolic process

D-glucuronate catabolic process to D-xylulose 5-phosphate

small molecule biosynthetic process [inference]

vitamin biosynthetic process [inference]

water-soluble vitamin biosynthetic process [inference]

L-ascorbic acid biosynthetic process

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

L-ascorbic acid biosynthetic process

monosaccharide biosynthetic process [inference]

L-ascorbic acid biosynthetic process

carbohydrate derivative metabolic process [inference]

glycoside metabolic process [inference]

D-xylulose 5-phosphate metabolic process [inference]

D-glucuronate catabolic process to D-xylulose 5-phosphate

lactone metabolic process [inference]

L-ascorbic acid metabolic process [inference]

L-ascorbic acid biosynthetic process

lactone biosynthetic process [inference]

L-ascorbic acid biosynthetic process

cellular detoxification [inference]

cellular detoxification of aldehyde

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

regulation of cellular process [inference]

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

detoxification [inference]

cellular detoxification [inference]

cellular detoxification of aldehyde

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytosol	ISS	GO_REF
cytosol	ISO	GO_REF
cytosol	IBA	GO_REF
cytosol	IEA	GO_REF GO_REF
apical plasma membrane	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytosol

membrane [inference]

plasma membrane region [inference]

apical plasma membrane

cell junction [inference]

synapse

Displaying entries **1 - 5** of 23 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
aldose reductase (NADPH) activity	ISO	GO_REF
aldose reductase (NADPH) activity	IBA	GO_REF
aldose reductase (NADPH) activity	IEA	GO_REF
allyl-alcohol dehydrogenase activity	ISO	GO_REF
allyl-alcohol dehydrogenase activity	EXP	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

oxidoreductase activity, acting on CH-OH group of donors [inference]

oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

alcohol dehydrogenase [NAD(P)+] activity [inference]

alcohol dehydrogenase (NADP+) activity [inference]

aldose reductase (NADPH) activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	PubMed ID	Source
23	N-linked (Glc) (glycation) lysine	7827091	UniProt
68	N-linked (Glc) (glycation) lysine	7827091	UniProt
85	N-linked (Glc) (glycation) lysine	7827091	UniProt
141	N-linked (Glc) (glycation) lysine	7827091	UniProt
153	N-linked (Glc) (glycation) lysine	7827091	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Formation of xylulose-5-phosphate	Rattus norvegicus
Glutathione conjugation	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements