GlyCosmos Portal

Submissions

Gap junction beta-6 protein

Summary

UniProt ID: P70689
Gene Symbol: Cxn-30 Gjb6
Gene ID: 14623
Organism: Mus musculus (house mouse)

External Links

GlyGen: P70689
O-GlcNAcAtlas: P70689
Re-Glyco: P70689

Annotation

Keyword: Cell membrane Gap junction Hearing Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
cell-cell signaling	IBA	GO_REF
sensory perception of sound	IMP	PMID
negative regulation of cell population proliferation	ISO	GO_REF
gap junction assembly	ISO	GO_REF
gap junction assembly	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling

intercellular transport [inference]

gap junction-mediated intercellular transport

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

transmembrane transport

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

cell junction assembly [inference]

cell-cell junction assembly [inference]

gap junction assembly

cell junction organization [inference]

cell junction assembly [inference]

cell-cell junction assembly [inference]

gap junction assembly

cell-cell junction organization [inference]

cell-cell junction assembly [inference]

gap junction assembly

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of mechanical stimulus [inference]

sensory perception of sound

developmental process [inference]

anatomical structure morphogenesis [inference]

animal organ morphogenesis [inference]

embryonic organ morphogenesis [inference]

ear morphogenesis

sensory organ morphogenesis [inference]

ear morphogenesis

embryonic morphogenesis [inference]

embryonic organ morphogenesis [inference]

ear morphogenesis

anatomical structure development [inference]

inner ear development

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

chemical homeostasis [inference]

carbohydrate homeostasis [inference]

glucose homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

intracellular chemical homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

response to stimulus [inference]

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to abiotic stimulus [inference]

response to electrical stimulus

response to chemical [inference]

response to lipid [inference]

response to lipopolysaccharide

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

response to oxygen-containing compound [inference]

response to carbohydrate [inference]

response to monosaccharide [inference]

response to hexose [inference]

response to glucose [inference]

cellular response to glucose stimulus

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

response to lipopolysaccharide

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

localization [inference]

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

gap junction-mediated intercellular transport

transmembrane transport

biological regulation [inference]

regulation of biological process [inference]

signaling [inference]

cell-cell signaling

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

regulation of cellular process [inference]

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
actin filament	ISO	GO_REF
actin filament	IEA	GO_REF
gap junction	ISO	GO_REF GO_REF
gap junction	IDA	PMID PMID PMID
gap junction	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

connexin complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane region [inference]

apical plasma membrane

cell junction

anchoring junction [inference]

cell-cell junction [inference]

gap junction

supramolecular complex [inference]

supramolecular polymer [inference]

supramolecular fiber [inference]

polymeric cytoskeletal fiber [inference]

actin filament

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
gap junction channel activity	ISO	GO_REF
gap junction channel activity	IBA	GO_REF
gap junction channel activity	IEA	GO_REF
microtubule binding	ISO	GO_REF
microtubule binding	IEA	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

passive transmembrane transporter activity [inference]

channel activity [inference]

wide pore channel activity [inference]

gap junction channel activity

gap junction channel activity involved in cell communication by electrical coupling

binding [inference]

protein binding [inference]

cytoskeletal protein binding [inference]

actin binding [inference]

actin filament binding

tubulin binding [inference]

protein-containing complex binding [inference]

actin filament binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDWGTLHTVIGGVNKHSTSIGKVWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGCKNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHETARKFIRGEKRNEFKDLEDIKRQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDCFISRPTEKTVFTVFMISASVICMLLNVAELCYLLLKLCFRRSKRTQAQRNHPNHALKESKQNEMNELISDSGQNAITSFPS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
257			G49108TO	GlyGen
261			G49108TO	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Gap junction assembly	Mus musculus

Disease

Displaying **all 2** entries
DO ID	Disease Name	Source
DOID:14693	Clouston syndrome	Alliance of Genome Resources
DOID:0110475	autosomal recessive nonsyndromic deafness 1A	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements