GlyCosmos Portal

Submissions

SMAD family member 4

Summary

UniProt ID: P97471
Gene Symbol: Dpc4 Madh4 Smad4
Gene ID: 17128
Organism: Mus musculus (house mouse)

External Links

GlyGen: P97471
PubChem: P97471
The Human Metabolome Database: HMDBP14461
Re-Glyco: P97471

Annotation

Keyword: 3D-structure Acetylation Cytoplasm DNA-binding Isopeptide bond Metal-binding Nucleus Reference proteome Transcription regulation Ubl conjugation Zinc

Gene Ontology (GO)

Displaying entries **16 - 20** of **141** in total

« First

‹ Prev

1

2

3

4

5

6

7

8

…

Next ›

Last »
GO Term	Evidence Code	Reference
atrioventricular valve formation	IGI	PMID
epithelial to mesenchymal transition involved in endocardial cushion formation	IMP	PMID
left ventricular cardiac muscle tissue morphogenesis	IMP	PMID
obsolete positive regulation of cell proliferation involved in heart valve morphogenesis
cardiac septum development	IGI	PMID

GO Hierarchy

biological process

cellular process [inference]

cell activation [inference]

endothelial cell activation

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

interleukin-6-mediated signaling pathway

extrinsic apoptotic signaling pathway

intracellular signal transduction

intracellular signaling cassette [inference]

MAPK cascade [inference]

ERK1 and ERK2 cascade

SMAD protein signal transduction

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

cell population proliferation

cellular developmental process [inference]

cell fate specification [inference]

neuron fate specification

cell differentiation

osteoblast differentiation

epithelial cell differentiation [inference]

endothelial cell differentiation [inference]

cardiac endothelial cell differentiation [inference]

endocardial cell differentiation

cardiocyte differentiation [inference]

cardiac endothelial cell differentiation [inference]

endocardial cell differentiation

mesenchymal cell differentiation [inference]

epithelial to mesenchymal transition

cardiac epithelial to mesenchymal transition [inference]

epithelial to mesenchymal transition involved in endocardial cushion formation

neural crest cell differentiation

stem cell differentiation [inference]

neural crest cell differentiation

cell fate commitment [inference]

neuron fate commitment

cell motility [inference]

cell migration [inference]

ameboidal-type cell migration [inference]

epithelial cell migration

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection guidance [inference]

axon guidance

reproductive process [inference]

developmental process involved in reproduction [inference]

spermatogenesis

gonad morphogenesis [inference]

female gonad morphogenesis

reproductive structure development [inference]

gonad development [inference]

fertilization [inference]

single fertilization

multicellular organismal reproductive process [inference]

gamete generation [inference]

male gamete generation [inference]

spermatogenesis

multicellular organismal process [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in ureteric bud morphogenesis

cell activation [inference]

endothelial cell activation

system process [inference]

muscle system process [inference]

muscle hypertrophy [inference]

muscle hypertrophy in response to stress [inference]

cardiac muscle hypertrophy in response to stress

striated muscle hypertrophy [inference]

cardiac muscle hypertrophy [inference]

cardiac muscle hypertrophy in response to stress

muscle adaptation [inference]

muscle hypertrophy in response to stress [inference]

cardiac muscle hypertrophy in response to stress

striated muscle adaptation [inference]

cardiac muscle adaptation [inference]

cardiac muscle hypertrophy in response to stress

multicellular organism development [inference]

embryo development [inference]

embryo development ending in birth or egg hatching [inference]

chordate embryonic development [inference]

in utero embryonic development

pattern specification process [inference]

regionalization [inference]

anterior/posterior pattern specification

axis specification [inference]

embryonic axis specification [inference]

somite rostral/caudal axis specification

anterior/posterior axis specification [inference]

somite rostral/caudal axis specification

embryonic pattern specification [inference]

embryonic axis specification [inference]

somite rostral/caudal axis specification

developmental process [inference]

developmental process involved in reproduction [inference]

spermatogenesis

gonad morphogenesis [inference]

female gonad morphogenesis

reproductive structure development [inference]

gonad development [inference]

anatomical structure morphogenesis

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in ureteric bud morphogenesis

animal organ morphogenesis [inference]

gonad morphogenesis [inference]

female gonad morphogenesis

tube morphogenesis [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in ureteric bud morphogenesis

embryonic morphogenesis [inference]

gastrulation

gastrulation with mouth forming second

embryonic digit morphogenesis

tissue morphogenesis

morphogenesis of an epithelium [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in ureteric bud morphogenesis

muscle tissue morphogenesis [inference]

cardiac muscle tissue morphogenesis [inference]

ventricular cardiac muscle tissue morphogenesis [inference]

left ventricular cardiac muscle tissue morphogenesis

mesenchyme morphogenesis [inference]

kidney mesenchyme morphogenesis [inference]

cardiac septum morphogenesis [inference]

anatomical structure formation involved in morphogenesis [inference]

heart valve formation [inference]

atrioventricular valve formation

formation of anatomical boundary

anatomical structure development [inference]

multicellular organism development [inference]

embryo development [inference]

embryo development ending in birth or egg hatching [inference]

chordate embryonic development [inference]

in utero embryonic development

tissue development [inference]

tube development [inference]

seminiferous tubule development

atrioventricular canal development

animal organ development [inference]

kidney development

gonad development [inference]

gland development [inference]

uterus development

reproductive structure development [inference]

gonad development [inference]

roof of mouth development [inference]

secondary palate development

cellular developmental process [inference]

cell fate specification [inference]

neuron fate specification

cell differentiation

osteoblast differentiation

epithelial cell differentiation [inference]

endothelial cell differentiation [inference]

cardiac endothelial cell differentiation [inference]

endocardial cell differentiation

cardiocyte differentiation [inference]

cardiac endothelial cell differentiation [inference]

endocardial cell differentiation

mesenchymal cell differentiation [inference]

epithelial to mesenchymal transition

cardiac epithelial to mesenchymal transition [inference]

epithelial to mesenchymal transition involved in endocardial cushion formation

neural crest cell differentiation

stem cell differentiation [inference]

neural crest cell differentiation

cell fate commitment [inference]

neuron fate commitment

growth [inference]

developmental growth

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular iron ion homeostasis

chemical homeostasis [inference]

carbohydrate homeostasis [inference]

glucose homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular iron ion homeostasis

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular iron ion homeostasis

intracellular chemical homeostasis [inference]

intracellular glucose homeostasis [inference]

cellular response to glucose stimulus

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular iron ion homeostasis

inorganic ion homeostasis [inference]

intracellular iron ion homeostasis

response to stimulus [inference]

response to stress [inference]

response to hypoxia

muscle hypertrophy in response to stress [inference]

cardiac muscle hypertrophy in response to stress

response to abiotic stimulus [inference]

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia

response to endogenous stimulus [inference]

response to growth factor [inference]

cellular response to growth factor stimulus [inference]

cellular response to transforming growth factor beta stimulus

response to transforming growth factor beta

cellular response to transforming growth factor beta stimulus

cellular response to endogenous stimulus [inference]

cellular response to growth factor stimulus [inference]

cellular response to transforming growth factor beta stimulus

response to chemical [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

response to oxygen-containing compound [inference]

response to carbohydrate [inference]

response to monosaccharide [inference]

response to hexose [inference]

response to glucose [inference]

cellular response to glucose stimulus

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

muscle adaptation [inference]

muscle hypertrophy in response to stress [inference]

cardiac muscle hypertrophy in response to stress

striated muscle adaptation [inference]

cardiac muscle adaptation [inference]

cardiac muscle hypertrophy in response to stress

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to carbohydrate stimulus [inference]

cellular response to monosaccharide stimulus [inference]

cellular response to hexose stimulus [inference]

cellular response to glucose stimulus

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of SMAD protein signal transduction [inference]

positive regulation of SMAD protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of hormone secretion [inference]

regulation of gonadotropin secretion [inference]

positive regulation of gonadotropin secretion [inference]

regulation of luteinizing hormone secretion [inference]

positive regulation of luteinizing hormone secretion

regulation of follicle-stimulating hormone secretion [inference]

positive regulation of follicle-stimulating hormone secretion

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

regulation of gonadotropin secretion [inference]

positive regulation of gonadotropin secretion [inference]

regulation of luteinizing hormone secretion [inference]

positive regulation of luteinizing hormone secretion

regulation of follicle-stimulating hormone secretion [inference]

positive regulation of follicle-stimulating hormone secretion

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

regulation of growth [inference]

regulation of cell growth [inference]

negative regulation of cell growth

negative regulation of growth [inference]

negative regulation of cell growth

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of muscle cell apoptotic process [inference]

positive regulation of striated muscle cell apoptotic process [inference]

positive regulation of cardiac muscle cell apoptotic process

positive regulation of cellular component biogenesis [inference]

positive regulation of extracellular matrix assembly

positive regulation of cell differentiation [inference]

positive regulation of epithelial to mesenchymal transition

positive regulation of cellular component organization [inference]

positive regulation of extracellular matrix organization [inference]

positive regulation of extracellular matrix assembly

positive regulation of secretion by cell [inference]

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of cellular response to transforming growth factor beta stimulus [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of epithelial to mesenchymal transition

positive regulation of multicellular organismal process [inference]

positive regulation of epithelial to mesenchymal transition

positive regulation of gonadotropin secretion [inference]

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of growth [inference]

negative regulation of cell growth

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of cell growth

negative regulation of cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of striated muscle cell differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

negative regulation of cardiocyte differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of cardiac myofibril assembly

negative regulation of organelle assembly [inference]

negative regulation of cardiac myofibril assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of cardiac myofibril assembly

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of striated muscle cell differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

negative regulation of cardiocyte differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

negative regulation of multicellular organismal process [inference]

negative regulation of muscle hypertrophy [inference]

negative regulation of cardiac muscle hypertrophy

negative regulation of cardiocyte differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of SMAD protein signal transduction [inference]

positive regulation of SMAD protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

regulation of muscle adaptation [inference]

regulation of cardiac muscle hypertrophy [inference]

negative regulation of cardiac muscle hypertrophy

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of cellular response to transforming growth factor beta stimulus [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of cellular response to growth factor stimulus [inference]

regulation of cellular response to transforming growth factor beta stimulus [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of cellular response to transforming growth factor beta stimulus [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

regulation of developmental process [inference]

regulation of cell differentiation [inference]

regulation of epithelial to mesenchymal transition [inference]

positive regulation of epithelial to mesenchymal transition

negative regulation of cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of striated muscle cell differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

negative regulation of cardiocyte differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

positive regulation of cell differentiation [inference]

positive regulation of epithelial to mesenchymal transition

regulation of muscle cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of striated muscle cell differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

regulation of striated muscle cell differentiation [inference]

negative regulation of striated muscle cell differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

regulation of cell development [inference]

regulation of cardiac myofibril assembly [inference]

negative regulation of cardiac myofibril assembly

regulation of cardiocyte differentiation [inference]

negative regulation of cardiocyte differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of striated muscle cell differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

negative regulation of cardiocyte differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of epithelial to mesenchymal transition

regulation of multicellular organismal development [inference]

regulation of hair follicle development

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

interleukin-6-mediated signaling pathway

extrinsic apoptotic signaling pathway

intracellular signal transduction

intracellular signaling cassette [inference]

MAPK cascade [inference]

ERK1 and ERK2 cascade

SMAD protein signal transduction

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of SMAD protein signal transduction [inference]

positive regulation of SMAD protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of hormone secretion [inference]

regulation of gonadotropin secretion [inference]

positive regulation of gonadotropin secretion [inference]

regulation of luteinizing hormone secretion [inference]

positive regulation of luteinizing hormone secretion

regulation of follicle-stimulating hormone secretion [inference]

positive regulation of follicle-stimulating hormone secretion

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

regulation of transforming growth factor beta production [inference]

regulation of transforming growth factor beta2 production

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

regulation of transforming growth factor beta production [inference]

regulation of transforming growth factor beta2 production

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of miRNA metabolic process [inference]

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of miRNA metabolic process [inference]

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

positive regulation of miRNA transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process

regulation of actin filament-based process [inference]

regulation of actin cytoskeleton organization [inference]

regulation of actomyosin structure organization [inference]

regulation of cardiac myofibril assembly [inference]

negative regulation of cardiac myofibril assembly

regulation of cell population proliferation

negative regulation of cell population proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

regulation of muscle cell apoptotic process [inference]

positive regulation of muscle cell apoptotic process [inference]

positive regulation of striated muscle cell apoptotic process [inference]

positive regulation of cardiac muscle cell apoptotic process

regulation of striated muscle cell apoptotic process [inference]

positive regulation of striated muscle cell apoptotic process [inference]

positive regulation of cardiac muscle cell apoptotic process

regulation of cardiac muscle cell apoptotic process [inference]

positive regulation of cardiac muscle cell apoptotic process

positive regulation of apoptotic process [inference]

positive regulation of muscle cell apoptotic process [inference]

positive regulation of striated muscle cell apoptotic process [inference]

positive regulation of cardiac muscle cell apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of muscle cell apoptotic process [inference]

positive regulation of striated muscle cell apoptotic process [inference]

positive regulation of cardiac muscle cell apoptotic process

regulation of cellular component biogenesis [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of extracellular matrix assembly

regulation of extracellular matrix assembly [inference]

positive regulation of extracellular matrix assembly

regulation of organelle assembly [inference]

negative regulation of organelle assembly [inference]

negative regulation of cardiac myofibril assembly

regulation of cardiac myofibril assembly [inference]

negative regulation of cardiac myofibril assembly

regulation of cell differentiation [inference]

regulation of epithelial to mesenchymal transition [inference]

positive regulation of epithelial to mesenchymal transition

negative regulation of cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of striated muscle cell differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

negative regulation of cardiocyte differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

positive regulation of cell differentiation [inference]

positive regulation of epithelial to mesenchymal transition

regulation of muscle cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of striated muscle cell differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

regulation of striated muscle cell differentiation [inference]

negative regulation of striated muscle cell differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

regulation of cell development [inference]

regulation of cardiac myofibril assembly [inference]

negative regulation of cardiac myofibril assembly

regulation of cardiocyte differentiation [inference]

negative regulation of cardiocyte differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of muscle cell apoptotic process [inference]

positive regulation of striated muscle cell apoptotic process [inference]

positive regulation of cardiac muscle cell apoptotic process

positive regulation of cellular component biogenesis [inference]

positive regulation of extracellular matrix assembly

positive regulation of cell differentiation [inference]

positive regulation of epithelial to mesenchymal transition

positive regulation of cellular component organization [inference]

positive regulation of extracellular matrix organization [inference]

positive regulation of extracellular matrix assembly

positive regulation of secretion by cell [inference]

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of cell growth

negative regulation of cell differentiation [inference]

negative regulation of muscle cell differentiation [inference]

negative regulation of striated muscle cell differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

negative regulation of cardiocyte differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of cardiac myofibril assembly

negative regulation of organelle assembly [inference]

negative regulation of cardiac myofibril assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of cardiac myofibril assembly

regulation of cellular component organization [inference]

regulation of cell growth [inference]

negative regulation of cell growth

regulation of organelle organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of cardiac myofibril assembly

negative regulation of organelle assembly [inference]

negative regulation of cardiac myofibril assembly

regulation of cytoskeleton organization [inference]

regulation of actin cytoskeleton organization [inference]

regulation of actomyosin structure organization [inference]

regulation of cardiac myofibril assembly [inference]

negative regulation of cardiac myofibril assembly

negative regulation of cytoskeleton organization [inference]

negative regulation of cardiac myofibril assembly

regulation of organelle assembly [inference]

negative regulation of organelle assembly [inference]

negative regulation of cardiac myofibril assembly

regulation of cardiac myofibril assembly [inference]

negative regulation of cardiac myofibril assembly

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of cardiac myofibril assembly

negative regulation of organelle assembly [inference]

negative regulation of cardiac myofibril assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of cardiac myofibril assembly

positive regulation of cellular component organization [inference]

positive regulation of extracellular matrix organization [inference]

positive regulation of extracellular matrix assembly

regulation of supramolecular fiber organization [inference]

negative regulation of supramolecular fiber organization [inference]

negative regulation of cardiac myofibril assembly

regulation of cardiac myofibril assembly [inference]

negative regulation of cardiac myofibril assembly

regulation of extracellular matrix organization [inference]

regulation of extracellular matrix assembly [inference]

positive regulation of extracellular matrix assembly

positive regulation of extracellular matrix organization [inference]

positive regulation of extracellular matrix assembly

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

regulation of gonadotropin secretion [inference]

positive regulation of gonadotropin secretion [inference]

regulation of luteinizing hormone secretion [inference]

positive regulation of luteinizing hormone secretion

regulation of follicle-stimulating hormone secretion [inference]

positive regulation of follicle-stimulating hormone secretion

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

regulation of transforming growth factor beta production [inference]

regulation of transforming growth factor beta2 production

regulation of hair cycle [inference]

regulation of hair follicle development

regulation of system process [inference]

regulation of endocrine process [inference]

regulation of gonadotropin secretion [inference]

positive regulation of gonadotropin secretion [inference]

regulation of luteinizing hormone secretion [inference]

positive regulation of luteinizing hormone secretion

regulation of follicle-stimulating hormone secretion [inference]

positive regulation of follicle-stimulating hormone secretion

regulation of muscle system process [inference]

regulation of muscle hypertrophy [inference]

regulation of cardiac muscle hypertrophy [inference]

negative regulation of cardiac muscle hypertrophy

negative regulation of muscle hypertrophy [inference]

negative regulation of cardiac muscle hypertrophy

regulation of muscle adaptation [inference]

regulation of cardiac muscle hypertrophy [inference]

negative regulation of cardiac muscle hypertrophy

positive regulation of multicellular organismal process [inference]

positive regulation of epithelial to mesenchymal transition

positive regulation of gonadotropin secretion [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of muscle hypertrophy [inference]

negative regulation of cardiac muscle hypertrophy

negative regulation of cardiocyte differentiation [inference]

negative regulation of cardiac muscle cell differentiation [inference]

negative regulation of cardiac myofibril assembly

regulation of multicellular organismal development [inference]

regulation of hair follicle development

regulation of biological quality [inference]

regulation of hormone levels [inference]

regulation of hormone secretion [inference]

regulation of gonadotropin secretion [inference]

positive regulation of gonadotropin secretion [inference]

regulation of luteinizing hormone secretion [inference]

positive regulation of luteinizing hormone secretion

regulation of follicle-stimulating hormone secretion [inference]

positive regulation of follicle-stimulating hormone secretion

positive regulation of hormone secretion [inference]

positive regulation of gonadotropin secretion [inference]

Displaying entries **1 - 5** of 31 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
chromatin	ISO	GO_REF
chromatin	IEA	GO_REF
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF
nucleus	IDA	PMID PMID PMID PMID

GO Hierarchy

cellular component

protein-containing complex

transcription regulator complex

RNA polymerase II transcription regulator complex

SMAD protein complex

heteromeric SMAD protein complex

nuclear protein-containing complex [inference]

RNA polymerase II transcription regulator complex

cellular anatomical structure [inference]

microtubule organizing center [inference]

cytosol

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying entries **1 - 5** of 47 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
transcription cis-regulatory region binding	ISO	GO_REF
transcription cis-regulatory region binding	IEA	GO_REF
RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	PMID
RNA polymerase II transcription regulatory region sequence-specific DNA binding	IGI	PMID
RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

DNA binding

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

sequence-specific DNA binding

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

chromatin binding

protein binding [inference]

cytoskeletal protein binding [inference]

filamin binding

transcription factor binding [inference]

transcription coregulator binding [inference]

DNA-binding transcription factor binding [inference]

RNA polymerase II-specific DNA-binding transcription factor binding

identical protein binding

protein homodimerization activity

SMAD binding

protein dimerization activity [inference]

protein homodimerization activity

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

sulfate binding

cation binding [inference]

metal ion binding

protein-containing complex binding

collagen binding

sulfur compound binding [inference]

sulfate binding

transcription regulator activity [inference]

DNA-binding transcription factor activity

DNA-binding transcription factor activity, RNA polymerase II-specific

DNA-binding transcription activator activity, RNA polymerase II-specific

DNA-binding transcription activator activity [inference]

DNA-binding transcription activator activity, RNA polymerase II-specific

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSMLVKDEYVHDFEGQPSLPTEGHSIQTIQHPPSNRASTETYSAPALLAPAESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQIASGPQPGQQQNGFTAQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPVVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
3			G02815KT	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 10** entries
Pathway Name	Organism
Downregulation of SMAD2/3:SMAD4 transcriptional activity	Mus musculus
FOXO-mediated transcription of cell cycle genes	Mus musculus
RUNX2 regulates bone development	Mus musculus
RUNX3 regulates CDKN1A transcription	Mus musculus
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription	Mus musculus
Signaling by Activin	Mus musculus
Signaling by BMP	Mus musculus
Signaling by NODAL	Mus musculus
TGF-beta receptor signaling activates SMADs	Mus musculus
Ub-specific processing proteases	Mus musculus

Disease

Displaying **all 2** entries
DO ID	Disease Name	Source
DOID:12347	osteogenesis imperfecta	Alliance of Genome Resources
DOID:0050787	juvenile polyposis syndrome	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements