GlyCosmos Portal

Submissions

Collagen alpha-3(IV) chain

Summary

UniProt ID: Q01955
Gene Symbol: COL4A3
Gene ID: 1285
Organism: Homo sapiens (human)

External Links

GlyGen: Q01955
PubChem: Q01955
The O-GlcNAc Database: Q01955
Re-Glyco: Q01955

Annotation

Keyword: 3D-structure Alport syndrome Alternative splicing Basement membrane Cell adhesion Collagen Deafness Direct protein sequencing Disease variant Disulfide bond Glycoprotein Hydroxylation Phosphoprotein Proteomics identification Reference proteome Repeat Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
cell adhesion
cell surface receptor signaling pathway	NAS	PMID
cell surface receptor signaling pathway	IEA	GO_REF
sensory perception of sound	TAS	PMID
negative regulation of cell population proliferation	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

cell adhesion

signal transduction [inference]

cell surface receptor signaling pathway

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

collagen-activated tyrosine kinase receptor signaling pathway

collagen-activated signaling pathway [inference]

collagen-activated tyrosine kinase receptor signaling pathway

cell death [inference]

programmed cell death [inference]

apoptotic process [inference]

endothelial cell apoptotic process

cellular component organization or biogenesis [inference]

cellular component organization [inference]

extracellular structure organization [inference]

extracellular matrix organization [inference]

external encapsulating structure organization [inference]

extracellular matrix organization [inference]

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of mechanical stimulus [inference]

sensory perception of sound

developmental process [inference]

anatomical structure development [inference]

glomerular basement membrane development

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation [inference]

negative regulation of vascular endothelial cell proliferation

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

collagen-activated tyrosine kinase receptor signaling pathway

collagen-activated signaling pathway [inference]

collagen-activated tyrosine kinase receptor signaling pathway

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation [inference]

negative regulation of vascular endothelial cell proliferation

regulation of epithelial cell proliferation [inference]

regulation of endothelial cell proliferation [inference]

negative regulation of endothelial cell proliferation [inference]

negative regulation of vascular endothelial cell proliferation

regulation of vascular endothelial cell proliferation [inference]

negative regulation of vascular endothelial cell proliferation

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation [inference]

negative regulation of vascular endothelial cell proliferation

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation [inference]

negative regulation of vascular endothelial cell proliferation

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
extracellular region	IEA	GO_REF
collagen type IV trimer	NAS	PMID
collagen type IV trimer	IDA	PMID
collagen type IV trimer	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

collagen trimer [inference]

network-forming collagen trimer [inference]

collagen type IV trimer

extracellular protein-containing complex [inference]

network-forming collagen trimer [inference]

collagen type IV trimer

cellular anatomical structure [inference]

extracellular region

external encapsulating structure [inference]

extracellular matrix

basement membrane

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

endoplasmic reticulum lumen

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
integrin binding	TAS	PMID
integrin binding	IDA	PMID
structural molecule activity	NAS	PMID
metalloendopeptidase inhibitor activity	NAS	PMID
extracellular matrix structural constituent conferring tensile strength	RCA	PMID PMID

GO Hierarchy

molecular function

structural molecule activity

extracellular matrix structural constituent [inference]

extracellular matrix structural constituent conferring tensile strength

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

integrin binding

cell adhesion molecule binding [inference]

integrin binding

protein-containing complex binding [inference]

integrin binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

peptidase regulator activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

endopeptidase regulator activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSARTAPRPQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPGSPGQKGFTGPEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPGNTGPYGLVGVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGDPGLPGAPGPQGLPGPPGFPGPVGPPGPPGFFGFPGAMGPRGPKGHMGERVIGHKGERGVKGLTGPPGPPGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSEKGAPGDPGLQGKPGKDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPGPPGPRGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSPGCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKGEKGETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQGEPGLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSLGKCGDPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGDPGIPGLDRSGFPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRGIPGSMGNMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGDMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLPGPRGDPGFQGFPGVKGEKGNPGFLGSIGPPGPIGPKGPPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKPGKDGKPGTPGPAGEKGNKGSKGEPGPAGSDGLPGLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying entries **1 - 10** of 11 in total

1

2

Next ›

Last »
Position	Description	PubMed ID	GlyTouCan ID	Source
110				GlyGen
253	N-linked (GlcNAc...) asparagine			UniProt GlyGen
358				GlyGen
382		37217939 38253038	G49108TO	The O-GlcNAc Database
573				GlyGen
754				GlyGen
781				GlyGen
911				GlyGen
1070				GlyGen
1299				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 14 in total

1

2

Next ›

Last »
Pathway Name	Organism
Anchoring fibril formation	Homo sapiens
Assembly of collagen fibrils and other multimeric structures	Homo sapiens
Attachment of bacteria to epithelial cells	Homo sapiens
Collagen biosynthesis and modifying enzymes	Homo sapiens
Collagen chain trimerization	Homo sapiens
Collagen degradation	Homo sapiens
Crosslinking of collagen fibrils	Homo sapiens
ECM proteoglycans	Homo sapiens
Fibronectin matrix formation	Homo sapiens
Integrin cell surface interactions	Homo sapiens

Disease

Displaying **all 5** entries
DO ID	Disease Name	Source
DOID:0111365	benign familial hematuria	Alliance of Genome Resources
DOID:0110032	Alport syndrome 3A	Alliance of Genome Resources
DOID:0110033	Alport syndrome 2	Alliance of Genome Resources
DOID:783	end stage renal disease	Alliance of Genome Resources
DOID:10983	Alport syndrome	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements