GlyCosmos Portal

Vesicular glutamate transporter 1

Summary

UniProt ID: Q05B21
Gene Symbol: slc17a7 vglut1
Gene ID: 780064
Organism: Xenopus tropicalis (tropical clawed frog)

External Links

Re-Glyco: Q05B21

Annotation

Keyword: Antiport Cell membrane Chloride channel Cytoplasmic vesicle Glycoprotein Neurotransmitter transport Phosphate transport Reference proteome Sodium transport Symport Synaptosome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
potassium ion transport	ISS	GO_REF
phosphate ion transport	ISS	GO_REF
chloride transport	ISS	GO_REF
L-glutamate transmembrane transport	ISS	GO_REF
synaptic transmission, glutamatergic	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission [inference]

synaptic transmission, glutamatergic

intercellular transport [inference]

neurotransmitter loading into synaptic vesicle

transmembrane transport [inference]

amino acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport [inference]

potassium ion transport

monoatomic anion transport [inference]

chloride transport

neurotransmitter transport [inference]

neurotransmitter loading into synaptic vesicle

amino acid transport [inference]

amino acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

acidic amino acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport

L-amino acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

intercellular transport [inference]

neurotransmitter loading into synaptic vesicle

inorganic anion transport [inference]

phosphate ion transport

sodium-dependent phosphate transport

chloride transport

organic anion transport [inference]

carboxylic acid transport [inference]

dicarboxylic acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport

L-amino acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

organic acid transport [inference]

carboxylic acid transport [inference]

dicarboxylic acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport

L-amino acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

transmembrane transport [inference]

amino acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

nitrogen compound transport [inference]

L-amino acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

establishment of localization in cell [inference]

neurotransmitter loading into synaptic vesicle

biological regulation [inference]

regulation of biological process [inference]

signaling [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission [inference]

synaptic transmission, glutamatergic

regulation of biological quality [inference]

regulation of synapse structure or activity

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	IEA	GO_REF
synaptic vesicle membrane	ISS	GO_REF
synaptic vesicle membrane	IBA	GO_REF
synaptic vesicle membrane	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

transmembrane transporter complex [inference]

monoatomic ion channel complex [inference]

chloride channel complex

transporter complex [inference]

transmembrane transporter complex [inference]

monoatomic ion channel complex [inference]

chloride channel complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

bounding membrane of organelle [inference]

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

cell junction [inference]

synapse [inference]

excitatory synapse

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
chloride channel activity	ISS	GO_REF
L-glutamate transmembrane transporter activity	IBA	GO_REF
neurotransmitter transmembrane transporter activity	IBA	GO_REF
sodium:phosphate symporter activity	ISS	GO_REF
potassium:proton antiporter activity	ISS	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

neurotransmitter transmembrane transporter activity

monoatomic ion transmembrane transporter activity [inference]

monoatomic ion channel activity [inference]

monoatomic anion channel activity [inference]

chloride channel activity

monoatomic cation transmembrane transporter activity [inference]

proton transmembrane transporter activity [inference]

metal cation:proton antiporter activity [inference]

potassium:proton antiporter activity

solute:monoatomic cation symporter activity [inference]

solute:sodium symporter activity [inference]

sodium:phosphate symporter activity

metal ion transmembrane transporter activity [inference]

potassium ion transmembrane transporter activity [inference]

solute:potassium antiporter activity [inference]

potassium:proton antiporter activity

sodium ion transmembrane transporter activity [inference]

solute:sodium symporter activity [inference]

sodium:phosphate symporter activity

metal cation:monoatomic cation antiporter activity [inference]

solute:potassium antiporter activity [inference]

potassium:proton antiporter activity

metal cation:proton antiporter activity [inference]

potassium:proton antiporter activity

monoatomic anion transmembrane transporter activity [inference]

monoatomic anion channel activity [inference]

chloride channel activity

chloride transmembrane transporter activity [inference]

chloride channel activity

amino acid transmembrane transporter activity [inference]

acidic amino acid transmembrane transporter activity [inference]

L-glutamate transmembrane transporter activity

L-glutamate uniporter activity

L-amino acid transmembrane transporter activity [inference]

L-glutamate transmembrane transporter activity

L-glutamate uniporter activity

passive transmembrane transporter activity [inference]

channel activity [inference]

monoatomic ion channel activity [inference]

monoatomic anion channel activity [inference]

chloride channel activity

active transmembrane transporter activity [inference]

secondary active transmembrane transporter activity [inference]

phosphate transmembrane transporter activity [inference]

uniporter activity [inference]

membrane potential driven uniporter activity [inference]

symporter activity [inference]

solute:monoatomic cation symporter activity [inference]

solute:sodium symporter activity [inference]

sodium:phosphate symporter activity

antiporter activity [inference]

metal cation:monoatomic cation antiporter activity [inference]

solute:potassium antiporter activity [inference]

potassium:proton antiporter activity

metal cation:proton antiporter activity [inference]

potassium:proton antiporter activity

carboxylic acid transmembrane transporter activity [inference]

L-amino acid transmembrane transporter activity [inference]

L-glutamate transmembrane transporter activity

L-glutamate uniporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEFRKEEFKKLAGNTLGHLHRILEKKQTNGETIELTEEGRPVIKEEKRQPVVDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYKGNKIVIEQAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYIEESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGFGMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPWAEPEETSDEKCGFIHEDELADESEEQSQAYGAYGSYGATQTTSQQNGGWTAEWEKKEEFIQDQGKDPYLYGTVAERDLS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
93	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Glutamate Neurotransmitter Release Cycle	Xenopus tropicalis
SLC-mediated transport of neurotransmitters	Xenopus tropicalis

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements