GlyCosmos Portal

Submissions

Peptidoglycan recognition protein 4

Summary

UniProt ID: Q0VB07
Gene Symbol: Pglyrp4 Pgrpib
Gene ID: 384997
Organism: Mus musculus (house mouse)

External Links

PubChem: Q0VB07
Re-Glyco: Q0VB07

Annotation

Keyword: Antibiotic Disulfide bond Glycoprotein Innate immunity Reference proteome Repeat Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
immune response	IBA	GO_REF
peptidoglycan catabolic process	IEA	GO_REF
detection of bacterium	ISO	GO_REF
killing of cells of another organism	ISO	GO_REF
negative regulation of type II interferon production	IMP	PMID

GO Hierarchy

biological process

immune system process [inference]

immune response

humoral immune response [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

innate immune response

cellular process [inference]

cell killing [inference]

killing of cells of another organism

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

carbohydrate derivative catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

macromolecule metabolic process [inference]

aminoglycan metabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

glycosaminoglycan metabolic process [inference]

peptidoglycan metabolic process [inference]

peptidoglycan catabolic process

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

macromolecule catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

carbohydrate derivative metabolic process [inference]

aminoglycan metabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

glycosaminoglycan metabolic process [inference]

peptidoglycan metabolic process [inference]

peptidoglycan catabolic process

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

carbohydrate derivative catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

peptidoglycan catabolic process

biological process involved in interspecies interaction between organisms [inference]

biological process involved in symbiotic interaction [inference]

biological process involved in interaction with host

response to other organism [inference]

response to bacterium [inference]

detection of bacterium

defense response to bacterium

defense response to Gram-positive bacterium

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

innate immune response

detection of other organism [inference]

detection of bacterium

disruption of anatomical structure in another organism [inference]

disruption of cell in another organism [inference]

killing of cells of another organism

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to bacterium

defense response to Gram-positive bacterium

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

innate immune response

immune response

humoral immune response [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

detection of bacterium

defense response to bacterium

defense response to Gram-positive bacterium

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

innate immune response

detection of other organism [inference]

detection of bacterium

detection of external biotic stimulus [inference]

detection of other organism [inference]

detection of bacterium

response to biotic stimulus [inference]

detection of biotic stimulus [inference]

detection of external biotic stimulus [inference]

detection of other organism [inference]

detection of bacterium

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

detection of bacterium

defense response to bacterium

defense response to Gram-positive bacterium

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

innate immune response

detection of other organism [inference]

detection of bacterium

detection of external biotic stimulus [inference]

detection of other organism [inference]

detection of bacterium

detection of stimulus [inference]

detection of biotic stimulus [inference]

detection of external biotic stimulus [inference]

detection of other organism [inference]

detection of bacterium

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

regulation of type II interferon production [inference]

negative regulation of type II interferon production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

regulation of type II interferon production [inference]

negative regulation of type II interferon production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

regulation of type II interferon production [inference]

negative regulation of type II interferon production

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of type II interferon production

Displaying **all 2** entries
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF
protein-containing complex	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex

cellular anatomical structure [inference]

extracellular region

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
zinc ion binding	IEA	GO_REF
N-acetylmuramoyl-L-alanine amidase activity	IBA	GO_REF
N-acetylmuramoyl-L-alanine amidase activity	IEA	GO_REF
peptidoglycan immune receptor activity	ISO	GO_REF
peptidoglycan immune receptor activity	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds [inference]

hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides [inference]

N-acetylmuramoyl-L-alanine amidase activity

peptidoglycan muralytic activity [inference]

N-acetylmuramoyl-L-alanine amidase activity

binding [inference]

protein binding [inference]

protein dimerization activity [inference]

protein heterodimerization activity

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

peptidoglycan binding

molecular transducer activity [inference]

signaling receptor activity [inference]

pattern recognition receptor activity [inference]

peptidoglycan immune receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLSWLLVFSILVLLAQGVSSWENPQTDQVSEGLQQLFGNISQLFEKGILGRDDVFTMVSREEWGAEAIGCSSKLSRPVDVLVIHHIPGLECHNKTVCSQKLRELQAYHIHNSWCDVAYNFLVGDDGRVYEGVGWNVQGSHDQGYKNISLGVAFFGTQEGHSPSPVALSAMKGLISYAVKKGHLSSKYIQPLLAKSEDCLVPPQKGKQKKACPHIVPRSVWGARDSHCSRMTLPAKYAIILHTAGRTCSQPDECRLLVRDLQSFFMNRLNACDIGYNFLVGQDGGVYEGVGWNNQGSKTDSYNDISLSITFMGTFTGSPPNAAALEAAQDLIRCAVVKGYLTPNYLLMGHSDVSNTLSPGQALYNIIKTWPHFKH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites