GlyCosmos Portal

Submissions

Aminoacyl tRNA synthase complex-interacting multifunctional protein 2

Summary

UniProt ID: Q13155
Gene Symbol: AIMP2 JTV1 PRO0992
Gene ID: 7965
Organism: Homo sapiens (human)

External Links

PubChem: Q13155
The O-GlcNAc Database: Q13155
RaftProt: Q13155
Re-Glyco: Q13155

Annotation

Keyword: 3D-structure Alternative splicing Apoptosis Cytoplasm Developmental protein Differentiation Direct protein sequencing Disease variant Leukodystrophy Nucleus Phosphoprotein Protein biosynthesis Proteomics identification Reference proteome Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
translation
apoptotic process
negative regulation of cell population proliferation
protein ubiquitination
positive regulation of protein ubiquitination

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

translation

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

translation

protein metabolic process [inference]

translation

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination

macromolecule modification [inference]

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination

primary metabolic process [inference]

protein metabolic process [inference]

translation

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination

cell death [inference]

programmed cell death [inference]

apoptotic process

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

lung epithelial cell differentiation [inference]

lung secretory cell differentiation [inference]

type II pneumocyte differentiation

lung cell differentiation [inference]

lung epithelial cell differentiation [inference]

lung secretory cell differentiation [inference]

type II pneumocyte differentiation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

protein-containing complex assembly

protein-containing complex organization [inference]

protein-containing complex assembly

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

lung epithelial cell differentiation [inference]

lung secretory cell differentiation [inference]

type II pneumocyte differentiation

lung cell differentiation [inference]

lung epithelial cell differentiation [inference]

lung secretory cell differentiation [inference]

type II pneumocyte differentiation

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

regulation of cellular process [inference]

regulation of metabolic process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of post-translational protein modification [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein ubiquitination [inference]

positive regulation of protein ubiquitination

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of post-translational protein modification [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein ubiquitination [inference]

positive regulation of protein ubiquitination

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

regulation of neuron apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISS	GO_REF
nucleus	IEA	GO_REF GO_REF
cytosol	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
cytosol	IDA	PMID
cytosol	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

intracellular protein-containing complex [inference]

aminoacyl-tRNA synthetase multienzyme complex

catalytic complex [inference]

aminoacyl-tRNA synthetase multienzyme complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying 1 entry
GO Term	Evidence Code	Reference
protein-macromolecule adaptor activity	IDA	PMID

GO Hierarchy

molecular function

molecular adaptor activity [inference]

protein-macromolecule adaptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
203		28510447 30379171 32870666 34019948 35138101 38665916 40307207 40914422	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Cytosolic tRNA aminoacylation	Homo sapiens
Selenoamino acid metabolism	Homo sapiens
Transcriptional and post-translational regulation of MITF-M expression and activity	Homo sapiens