GlyCosmos Portal

Submissions

Collagen alpha-1(III) chain

Summary

UniProt ID: Q3TVI5
Gene Symbol: Col3a1
Gene ID: 12825
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0004404
Re-Glyco: Q3TVI5

Annotation

Keyword: Calcium Collagen Disulfide bond Extracellular matrix Glycoprotein Hydroxylation Metal-binding Repeat Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
skeletal system development	IEA	GO_REF
cell-matrix adhesion	IEA	GO_REF
transforming growth factor beta receptor signaling pathway	IEA	GO_REF
integrin-mediated signaling pathway	IEA	GO_REF
heart development	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell adhesion [inference]

cell-substrate adhesion [inference]

cell-matrix adhesion

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

transforming growth factor beta receptor signaling pathway

integrin-mediated signaling pathway

cellular component organization or biogenesis [inference]

cellular component organization [inference]

extracellular structure organization [inference]

extracellular matrix organization [inference]

collagen fibril organization

external encapsulating structure organization [inference]

extracellular matrix organization [inference]

collagen fibril organization

supramolecular fiber organization

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

system development [inference]

skeletal system development

response to stimulus [inference]

response to stress [inference]

response to wounding [inference]

wound healing

response to abiotic stimulus [inference]

response to radiation

response to chemical [inference]

response to peptide [inference]

response to cytokine

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of immune response

regulation of immune response [inference]

negative regulation of immune response

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of immune response

negative regulation of response to stimulus [inference]

negative regulation of immune response

regulation of response to stimulus [inference]

negative regulation of response to stimulus [inference]

negative regulation of immune response

regulation of immune response [inference]

negative regulation of immune response

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

transforming growth factor beta receptor signaling pathway

integrin-mediated signaling pathway

Displaying **all 2** entries
GO Term	Evidence Code	Reference
collagen type III trimer	IEA	GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

protein-containing complex [inference]

collagen trimer [inference]

fibrillar collagen trimer [inference]

collagen type III trimer

extracellular protein-containing complex [inference]

fibrillar collagen trimer [inference]

collagen type III trimer

Displaying **all 5** entries
GO Term	Evidence Code	Reference
protease binding	IEA	GO_REF
integrin binding	IEA	GO_REF
extracellular matrix structural constituent	IEA	GO_REF GO_REF GO_REF
metal ion binding
platelet-derived growth factor binding	IEA	GO_REF

GO Hierarchy

molecular function

structural molecule activity [inference]

extracellular matrix structural constituent

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

integrin binding

growth factor binding [inference]

platelet-derived growth factor binding

enzyme binding [inference]

protease binding

cell adhesion molecule binding [inference]

integrin binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

protein-containing complex binding [inference]

integrin binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MMSFVQSGTWFLLTLLHPTLILAQQSNVDELGCSHLGQSYESRDVWKPEPCQICVCDSGSVLCDDIICDEEPLDCPNPEIPFGECCAICPQPSTPAPVLPDGHGPQGPKGDPGPPGIPGRNGDPGLPGQPGLPGPPGSPGICESCPTGGQNYSPQFDSYDVKSGVGGMGGYPGPAGPPGPPGPPGSSGHPGSPGSPGYQGPPGEPGQAGPAGPPGPPGALGPAGPAGKDGESGRPGRPGERGLPGPPGIKGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGDNGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGSPGQRGEPGPQGHAGAQGPPGPPGNNGSPGGKGEMGPAGIPGAPGLIGARGPPGPAGTNGIPGTRGPSGEPGKNGAKGEPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGANGLPGAAGERGPSGFRGPAGPNGIPGEKGPPGERGGPGPAGPRGVAGEPGRDGTPGGPGIRGMPGSPGGPGNDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGGPGLPGPAGKNGETGPQGPPGPTGPAGDKGDSGPPGPQGLQGIPGTGGPPGENGKPGEPGPKGEVGAPGAPGGKGDSGAPGERGPPGTAGIPGARGGAGPPGPEGGKGPAGPPGPPGASGSPGLQGMPGERGGPGSPGPKGEKGEPGGAGADGVPGKDGPRGPAGPIGPPGPAGQPGDKGEGGSPGLPGIAGPRGGPGERGEHGPPGPAGFPGAPGQNGEPGAKGERGAPGEKGEGGPPGPAGPTGSSGPAGPPGPQGVKGERGSPGGPGTAGFPGGRGLPGPPGNNGNPGPPGPSGAPGKDGPPGPAGNSGSPGNPGIAGPKGDAGQPGEKGPPGAQGPPGSPGPLGIAGLTGARGLAGPPGMPGPRGSPGPQGIKGESGKPGASGHNGERGPPGPQGLPGQPGTAGEPGRDGNPGSDGQPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPSGKSGDRGETGPAGPSGAPGPAGARGAPGPQGPRGDKGETGERGSNGIKGHRGFPGNPGPPGSPGAAGHQGAIGSPGPAGPRGPVGPHGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGGAAAIAGVGGEKSGGFSPYYGDDPMDFKINTEEIMSSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKMDAIKVFCNMETGETCINASPMTVPRKHWWTDSGAEKKHVWFGESMNGGFQFSYGPPDLPEDVVDVQLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKSLKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYQTRKAMRLPIIDIAPYDIGGPDQEFGVDIGPVCFL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites