GlyCosmos Portal

Submissions

Integrin beta

Summary

UniProt ID: Q542I8
Gene Symbol: Itgb2
Gene ID: 16414
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0005185
Re-Glyco: Q542I8

Annotation

Keyword: Calcium Cell adhesion Cell membrane Disulfide bond EGF-like domain Glycoprotein Integrin Magnesium Metal-binding Phagocytosis Phosphoprotein Proteomics identification Pyrrolidone carboxylic acid Receptor Reference proteome Repeat Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
leukocyte migration involved in inflammatory response	IEA	GO_REF
phagocytosis	IEA	GO_REF
leukocyte cell-cell adhesion	IEA	GO_REF
integrin-mediated signaling pathway	IEA	GO_REF
neutrophil chemotaxis	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte activation

leukocyte migration [inference]

leukocyte migration involved in inflammatory response

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

cellular extravasation

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

cellular process [inference]

cell activation [inference]

leukocyte activation

cell adhesion [inference]

cell-cell adhesion [inference]

leukocyte cell-cell adhesion

signal transduction [inference]

cell surface receptor signaling pathway [inference]

integrin-mediated signaling pathway

vesicle-mediated transport [inference]

endocytosis [inference]

phagocytosis

cell motility [inference]

cell migration [inference]

endothelial cell migration

leukocyte migration [inference]

leukocyte migration involved in inflammatory response

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

cellular extravasation

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

endocytosis [inference]

phagocytosis

import into cell [inference]

endocytosis [inference]

phagocytosis

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of nitric oxide biosynthetic process

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

integrin-mediated signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of nitric oxide biosynthetic process

regulation of nitric oxide biosynthetic process [inference]

positive regulation of nitric oxide biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of nitric oxide biosynthetic process

regulation of nitric oxide metabolic process [inference]

regulation of nitric oxide biosynthetic process [inference]

positive regulation of nitric oxide biosynthetic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of nitric oxide biosynthetic process

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

Displaying **all 3** entries
GO Term	Evidence Code	Reference
cell surface	IEA	GO_REF GO_REF
integrin alphaM-beta2 complex	IEA	GO_REF
membrane raft	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex [inference]

plasma membrane signaling receptor complex [inference]

integrin complex [inference]

integrin alphaM-beta2 complex

protein complex involved in cell adhesion [inference]

integrin complex [inference]

integrin alphaM-beta2 complex

membrane protein complex [inference]

plasma membrane protein complex [inference]

plasma membrane signaling receptor complex [inference]

integrin complex [inference]

integrin alphaM-beta2 complex

cellular anatomical structure [inference]

cell surface

membrane [inference]

membrane microdomain [inference]

membrane raft

Displaying **all 3** entries
GO Term	Evidence Code	Reference
protein-containing complex binding	IEA	GO_REF
metal ion binding
cell adhesion molecule binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

cell adhesion molecule binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

protein-containing complex binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLGPHSLLLALAGLFFLGSAVSQECTKYKVSSCRDCIQSGPGCSWCQKLNFTGPGEPDSLRCDTRAQLLLKGCPADDIMDPRSIANPEFDQRGQRKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAIMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFDYPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAYYKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGDCDGVQINNPVTFQVKVMASECIQEQSFVIRALGFTDTVTVQVRPQCECQCRDQSREQSLCGGKGVMECGICRCESGYIGKNCECQTQGRSSQELERNCRKDNSSIVCSGLGDCICGQCVCHTSDVPNKEIFGQYCECDNVNCERYNSQVCGGSDRGSCNCGKCSCKPGYEGSACQCQRSTTGCLNARLVECSGRGHCQCNRCICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKFDKGPFEKNCSVQCAGMTLQTIPLKKKPCKERDSEGCWITYTLQQKDGRNIYNIHVEDSLECVKGPNVAAIVGGTVVGVVLIGVLLLVIWKALTHLTDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
50				GlycoProtDB
254				GlycoProtDB
501				GlycoProtDB
625				GlycoProtDB
643				GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Disease

Displaying **all 2** entries
DO ID	Disease Name	Source
DOID:8893	psoriasis	Alliance of Genome Resources
DOID:0110910	leukocyte adhesion deficiency 1	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements